Anti DMXL2 pAb (ATL-HPA039375)

Atlas Antibodies

Catalog No.:
ATL-HPA039375-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: Dmx-like 2
Gene Name: DMXL2
Alternative Gene Name: KIAA0856, RC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041268: 66%, ENSRNOG00000009170: 67%
Entrez Gene ID: 23312
Uniprot ID: Q8TDJ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TKTSALSAKKDQPDFISHRMDDVPSHSKALSDGNGSSGIEWSNVTSSQYDWSQPIVKVDEEPLNLDWGEDHDSALDEEEDDAVGLVMKSTDA
Gene Sequence TKTSALSAKKDQPDFISHRMDDVPSHSKALSDGNGSSGIEWSNVTSSQYDWSQPIVKVDEEPLNLDWGEDHDSALDEEEDDAVGLVMKSTDA
Gene ID - Mouse ENSMUSG00000041268
Gene ID - Rat ENSRNOG00000009170
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DMXL2 pAb (ATL-HPA039375)
Datasheet Anti DMXL2 pAb (ATL-HPA039375) Datasheet (External Link)
Vendor Page Anti DMXL2 pAb (ATL-HPA039375) at Atlas Antibodies

Documents & Links for Anti DMXL2 pAb (ATL-HPA039375)
Datasheet Anti DMXL2 pAb (ATL-HPA039375) Datasheet (External Link)
Vendor Page Anti DMXL2 pAb (ATL-HPA039375)
Citations for Anti DMXL2 pAb (ATL-HPA039375) – 2 Found
Wahab, Fazal; Drummer, Charis; Schlatt, Stefan; Behr, Rüdiger. Dynamic Regulation of Hypothalamic DMXL2, KISS1, and RFRP Expression During Postnatal Development in Non-Human Primates. Molecular Neurobiology. 2017;54(10):8447-8457.  PubMed
Crummy, Ellen; Mani, Muralidharan; Thellman, John C; Martin, Thomas F J. The priming factor CAPS1 regulates dense-core vesicle acidification by interacting with rabconnectin3β/WDR7 in neuroendocrine cells. The Journal Of Biological Chemistry. 2019;294(24):9402-9415.  PubMed