Anti DMXL2 pAb (ATL-HPA039375)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039375-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: DMXL2
Alternative Gene Name: KIAA0856, RC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041268: 66%, ENSRNOG00000009170: 67%
Entrez Gene ID: 23312
Uniprot ID: Q8TDJ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TKTSALSAKKDQPDFISHRMDDVPSHSKALSDGNGSSGIEWSNVTSSQYDWSQPIVKVDEEPLNLDWGEDHDSALDEEEDDAVGLVMKSTDA |
Gene Sequence | TKTSALSAKKDQPDFISHRMDDVPSHSKALSDGNGSSGIEWSNVTSSQYDWSQPIVKVDEEPLNLDWGEDHDSALDEEEDDAVGLVMKSTDA |
Gene ID - Mouse | ENSMUSG00000041268 |
Gene ID - Rat | ENSRNOG00000009170 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DMXL2 pAb (ATL-HPA039375) | |
Datasheet | Anti DMXL2 pAb (ATL-HPA039375) Datasheet (External Link) |
Vendor Page | Anti DMXL2 pAb (ATL-HPA039375) at Atlas Antibodies |
Documents & Links for Anti DMXL2 pAb (ATL-HPA039375) | |
Datasheet | Anti DMXL2 pAb (ATL-HPA039375) Datasheet (External Link) |
Vendor Page | Anti DMXL2 pAb (ATL-HPA039375) |
Citations for Anti DMXL2 pAb (ATL-HPA039375) – 2 Found |
Wahab, Fazal; Drummer, Charis; Schlatt, Stefan; Behr, Rüdiger. Dynamic Regulation of Hypothalamic DMXL2, KISS1, and RFRP Expression During Postnatal Development in Non-Human Primates. Molecular Neurobiology. 2017;54(10):8447-8457. PubMed |
Crummy, Ellen; Mani, Muralidharan; Thellman, John C; Martin, Thomas F J. The priming factor CAPS1 regulates dense-core vesicle acidification by interacting with rabconnectin3β/WDR7 in neuroendocrine cells. The Journal Of Biological Chemistry. 2019;294(24):9402-9415. PubMed |