Anti DMXL1 pAb (ATL-HPA036431)

Atlas Antibodies

SKU:
ATL-HPA036431-25
  • Immunohistochemical staining of human prostate shows moderate to strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli fibrillar center.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: Dmx-like 1
Gene Name: DMXL1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037416: 92%, ENSRNOG00000024671: 95%
Entrez Gene ID: 1657
Uniprot ID: Q9Y485
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LDVSGILATQVYTWVDDDIEVETKGSEDFLVIHARDDLTAVQGTTPYTHSNPGTPINMPWLGSTQTGRGASVMIKKAINNVRRMTSHPTLP
Gene Sequence LDVSGILATQVYTWVDDDIEVETKGSEDFLVIHARDDLTAVQGTTPYTHSNPGTPINMPWLGSTQTGRGASVMIKKAINNVRRMTSHPTLP
Gene ID - Mouse ENSMUSG00000037416
Gene ID - Rat ENSRNOG00000024671
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DMXL1 pAb (ATL-HPA036431)
Datasheet Anti DMXL1 pAb (ATL-HPA036431) Datasheet (External Link)
Vendor Page Anti DMXL1 pAb (ATL-HPA036431) at Atlas Antibodies

Documents & Links for Anti DMXL1 pAb (ATL-HPA036431)
Datasheet Anti DMXL1 pAb (ATL-HPA036431) Datasheet (External Link)
Vendor Page Anti DMXL1 pAb (ATL-HPA036431)