Anti DMWD pAb (ATL-HPA068172)
Atlas Antibodies
- Catalog No.:
- ATL-HPA068172-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: DMWD
Alternative Gene Name: D19S593E, DMR-N9, gene59
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030410: 96%, ENSRNOG00000014984: 96%
Entrez Gene ID: 1762
Uniprot ID: Q09019
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EPGTPFSIGRFATLTLQERRDRGAEKEHKRYHSLGNISRGGSGGS |
| Gene Sequence | EPGTPFSIGRFATLTLQERRDRGAEKEHKRYHSLGNISRGGSGGS |
| Gene ID - Mouse | ENSMUSG00000030410 |
| Gene ID - Rat | ENSRNOG00000014984 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DMWD pAb (ATL-HPA068172) | |
| Datasheet | Anti DMWD pAb (ATL-HPA068172) Datasheet (External Link) |
| Vendor Page | Anti DMWD pAb (ATL-HPA068172) at Atlas Antibodies |
| Documents & Links for Anti DMWD pAb (ATL-HPA068172) | |
| Datasheet | Anti DMWD pAb (ATL-HPA068172) Datasheet (External Link) |
| Vendor Page | Anti DMWD pAb (ATL-HPA068172) |