Anti DMWD pAb (ATL-HPA068172)
Atlas Antibodies
- SKU:
- ATL-HPA068172-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: DMWD
Alternative Gene Name: D19S593E, DMR-N9, gene59
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030410: 96%, ENSRNOG00000014984: 96%
Entrez Gene ID: 1762
Uniprot ID: Q09019
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EPGTPFSIGRFATLTLQERRDRGAEKEHKRYHSLGNISRGGSGGS |
Gene Sequence | EPGTPFSIGRFATLTLQERRDRGAEKEHKRYHSLGNISRGGSGGS |
Gene ID - Mouse | ENSMUSG00000030410 |
Gene ID - Rat | ENSRNOG00000014984 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DMWD pAb (ATL-HPA068172) | |
Datasheet | Anti DMWD pAb (ATL-HPA068172) Datasheet (External Link) |
Vendor Page | Anti DMWD pAb (ATL-HPA068172) at Atlas Antibodies |
Documents & Links for Anti DMWD pAb (ATL-HPA068172) | |
Datasheet | Anti DMWD pAb (ATL-HPA068172) Datasheet (External Link) |
Vendor Page | Anti DMWD pAb (ATL-HPA068172) |