Anti DMWD pAb (ATL-HPA068172)

Atlas Antibodies

SKU: ATL-HPA068172-25

• 
• 
• 

Protein Description: dystrophia myotonica, WD repeat containing
Gene Name: DMWD
Alternative Gene Name: D19S593E, DMR-N9, gene59
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030410: 96%, ENSRNOG00000014984: 96%
Entrez Gene ID: 1762
Uniprot ID: Q09019
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EPGTPFSIGRFATLTLQERRDRGAEKEHKRYHSLGNISRGGSGGS
• Gene Sequence: EPGTPFSIGRFATLTLQERRDRGAEKEHKRYHSLGNISRGGSGGS
• Gene ID - Mouse: ENSMUSG00000030410
• Gene ID - Rat: ENSRNOG00000014984
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.