Anti DMTN pAb (ATL-HPA058487)

Atlas Antibodies

Catalog No.:
ATL-HPA058487-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: dematin actin binding protein
Gene Name: DMTN
Alternative Gene Name: DMT, EPB49
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022099: 92%, ENSRNOG00000012273: 92%
Entrez Gene ID: 2039
Uniprot ID: Q08495
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DDDSGEEMKALRERQREELSKVTSNLGKMILKEEMEKSLPIRRKTRSLPDRTPFHTSLHQGT
Gene Sequence DDDSGEEMKALRERQREELSKVTSNLGKMILKEEMEKSLPIRRKTRSLPDRTPFHTSLHQGT
Gene ID - Mouse ENSMUSG00000022099
Gene ID - Rat ENSRNOG00000012273
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DMTN pAb (ATL-HPA058487)
Datasheet Anti DMTN pAb (ATL-HPA058487) Datasheet (External Link)
Vendor Page Anti DMTN pAb (ATL-HPA058487) at Atlas Antibodies

Documents & Links for Anti DMTN pAb (ATL-HPA058487)
Datasheet Anti DMTN pAb (ATL-HPA058487) Datasheet (External Link)
Vendor Page Anti DMTN pAb (ATL-HPA058487)