Anti DMTF1 pAb (ATL-HPA023846)

Atlas Antibodies

SKU:
ATL-HPA023846-25
  • Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cyclin D binding myb-like transcription factor 1
Gene Name: DMTF1
Alternative Gene Name: DMP1, DMTF, hDMP1, MRUL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042508: 91%, ENSRNOG00000005908: 91%
Entrez Gene ID: 9988
Uniprot ID: Q9Y222
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ASPTVTLTAAAPASPEQIIVHALSPEHLLNTSDNVTVQCHTPRVIIQTVATEDITSSISQAELTVDSDIQSSDFPEPPDALEADTFPDEIHHPKMTVEPSFNDAHVSKFSDQNSTELMNSVMVRTEEEI
Gene Sequence ASPTVTLTAAAPASPEQIIVHALSPEHLLNTSDNVTVQCHTPRVIIQTVATEDITSSISQAELTVDSDIQSSDFPEPPDALEADTFPDEIHHPKMTVEPSFNDAHVSKFSDQNSTELMNSVMVRTEEEI
Gene ID - Mouse ENSMUSG00000042508
Gene ID - Rat ENSRNOG00000005908
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DMTF1 pAb (ATL-HPA023846)
Datasheet Anti DMTF1 pAb (ATL-HPA023846) Datasheet (External Link)
Vendor Page Anti DMTF1 pAb (ATL-HPA023846) at Atlas Antibodies

Documents & Links for Anti DMTF1 pAb (ATL-HPA023846)
Datasheet Anti DMTF1 pAb (ATL-HPA023846) Datasheet (External Link)
Vendor Page Anti DMTF1 pAb (ATL-HPA023846)