Anti DMRTB1 pAb (ATL-HPA036490 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA036490-25

• 

Protein Description: DMRT-like family B with proline-rich C-terminal, 1
Gene Name: DMRTB1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028610: 56%, ENSRNOG00000023213: 55%
Entrez Gene ID: 63948
Uniprot ID: Q96MA1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NPDRALGPEYPGGSSMHPYCPFPLGYLDAPPGVPLQQGFRHVSRSQYQGGGLVSEPGGDFQPSYYLPPPPPPLPPLPPLPPQPQFLPPGYLSALH
• Gene Sequence: NPDRALGPEYPGGSSMHPYCPFPLGYLDAPPGVPLQQGFRHVSRSQYQGGGLVSEPGGDFQPSYYLPPPPPPLPPLPPLPPQPQFLPPGYLSALH
• Gene ID - Mouse: ENSMUSG00000028610
• Gene ID - Rat: ENSRNOG00000023213
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DMRTB1 pAb (ATL-HPA036490 w/enhanced validation) – 1 Found

Djureinovic, D; Fagerberg, L; Hallström, B; Danielsson, A; Lindskog, C; Uhlén, M; Pontén, F. The human testis-specific proteome defined by transcriptomics and antibody-based profiling. Molecular Human Reproduction. 2014;20(6):476-88.