Anti DMRTA1 pAb (ATL-HPA062253)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062253-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DMRTA1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043753: 70%, ENSRNOG00000024093: 70%
Entrez Gene ID: 63951
Uniprot ID: Q5VZB9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VPTLPFRPALDYAFSGMIRDSSYLSSKDSITCGRLYFRPN |
Gene Sequence | VPTLPFRPALDYAFSGMIRDSSYLSSKDSITCGRLYFRPN |
Gene ID - Mouse | ENSMUSG00000043753 |
Gene ID - Rat | ENSRNOG00000024093 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DMRTA1 pAb (ATL-HPA062253) | |
Datasheet | Anti DMRTA1 pAb (ATL-HPA062253) Datasheet (External Link) |
Vendor Page | Anti DMRTA1 pAb (ATL-HPA062253) at Atlas Antibodies |
Documents & Links for Anti DMRTA1 pAb (ATL-HPA062253) | |
Datasheet | Anti DMRTA1 pAb (ATL-HPA062253) Datasheet (External Link) |
Vendor Page | Anti DMRTA1 pAb (ATL-HPA062253) |