Anti DMRTA1 pAb (ATL-HPA044764)

Atlas Antibodies

Catalog No.:
ATL-HPA044764-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: DMRT-like family A1
Gene Name: DMRTA1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043753: 71%, ENSRNOG00000024093: 75%
Entrez Gene ID: 63951
Uniprot ID: Q5VZB9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YSNKPDSILSPHPGEQSGGEESPRSLSSSDLESGNESEWVKDLTATKASLPTVSSRPRDPLDILTKIFPNYRRSRLEGILRFCK
Gene Sequence YSNKPDSILSPHPGEQSGGEESPRSLSSSDLESGNESEWVKDLTATKASLPTVSSRPRDPLDILTKIFPNYRRSRLEGILRFCK
Gene ID - Mouse ENSMUSG00000043753
Gene ID - Rat ENSRNOG00000024093
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DMRTA1 pAb (ATL-HPA044764)
Datasheet Anti DMRTA1 pAb (ATL-HPA044764) Datasheet (External Link)
Vendor Page Anti DMRTA1 pAb (ATL-HPA044764) at Atlas Antibodies

Documents & Links for Anti DMRTA1 pAb (ATL-HPA044764)
Datasheet Anti DMRTA1 pAb (ATL-HPA044764) Datasheet (External Link)
Vendor Page Anti DMRTA1 pAb (ATL-HPA044764)