Anti DMRT2 pAb (ATL-HPA029297)

Atlas Antibodies

Catalog No.:
ATL-HPA029297-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: doublesex and mab-3 related transcription factor 2
Gene Name: DMRT2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048138: 86%, ENSRNOG00000016301: 85%
Entrez Gene ID: 10655
Uniprot ID: Q9Y5R5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VPGPDYNSYKSAYSPSPVEPPSKDFCNFLPTCLDLTMQYSGSGNMELISSNVSVATTYRQYPLSSRFLVWPKCGPISDTLLYQQCLLNATTSVQALKPGASWDLKGARVQDGLSAEQDMMPSKLEGSLVLPHTPEIQTTRSDLQGHQAVP
Gene Sequence VPGPDYNSYKSAYSPSPVEPPSKDFCNFLPTCLDLTMQYSGSGNMELISSNVSVATTYRQYPLSSRFLVWPKCGPISDTLLYQQCLLNATTSVQALKPGASWDLKGARVQDGLSAEQDMMPSKLEGSLVLPHTPEIQTTRSDLQGHQAVP
Gene ID - Mouse ENSMUSG00000048138
Gene ID - Rat ENSRNOG00000016301
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DMRT2 pAb (ATL-HPA029297)
Datasheet Anti DMRT2 pAb (ATL-HPA029297) Datasheet (External Link)
Vendor Page Anti DMRT2 pAb (ATL-HPA029297) at Atlas Antibodies

Documents & Links for Anti DMRT2 pAb (ATL-HPA029297)
Datasheet Anti DMRT2 pAb (ATL-HPA029297) Datasheet (External Link)
Vendor Page Anti DMRT2 pAb (ATL-HPA029297)