Anti DMRT2 pAb (ATL-HPA029297)

Atlas Antibodies

SKU: ATL-HPA029297-25

• 

Protein Description: doublesex and mab-3 related transcription factor 2
Gene Name: DMRT2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048138: 86%, ENSRNOG00000016301: 85%
Entrez Gene ID: 10655
Uniprot ID: Q9Y5R5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VPGPDYNSYKSAYSPSPVEPPSKDFCNFLPTCLDLTMQYSGSGNMELISSNVSVATTYRQYPLSSRFLVWPKCGPISDTLLYQQCLLNATTSVQALKPGASWDLKGARVQDGLSAEQDMMPSKLEGSLVLPHTPEIQTTRSDLQGHQAVP
• Gene Sequence: VPGPDYNSYKSAYSPSPVEPPSKDFCNFLPTCLDLTMQYSGSGNMELISSNVSVATTYRQYPLSSRFLVWPKCGPISDTLLYQQCLLNATTSVQALKPGASWDLKGARVQDGLSAEQDMMPSKLEGSLVLPHTPEIQTTRSDLQGHQAVP
• Gene ID - Mouse: ENSMUSG00000048138
• Gene ID - Rat: ENSRNOG00000016301
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.