Anti DMRT2 pAb (ATL-HPA029297)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029297-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DMRT2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048138: 86%, ENSRNOG00000016301: 85%
Entrez Gene ID: 10655
Uniprot ID: Q9Y5R5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VPGPDYNSYKSAYSPSPVEPPSKDFCNFLPTCLDLTMQYSGSGNMELISSNVSVATTYRQYPLSSRFLVWPKCGPISDTLLYQQCLLNATTSVQALKPGASWDLKGARVQDGLSAEQDMMPSKLEGSLVLPHTPEIQTTRSDLQGHQAVP |
Gene Sequence | VPGPDYNSYKSAYSPSPVEPPSKDFCNFLPTCLDLTMQYSGSGNMELISSNVSVATTYRQYPLSSRFLVWPKCGPISDTLLYQQCLLNATTSVQALKPGASWDLKGARVQDGLSAEQDMMPSKLEGSLVLPHTPEIQTTRSDLQGHQAVP |
Gene ID - Mouse | ENSMUSG00000048138 |
Gene ID - Rat | ENSRNOG00000016301 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DMRT2 pAb (ATL-HPA029297) | |
Datasheet | Anti DMRT2 pAb (ATL-HPA029297) Datasheet (External Link) |
Vendor Page | Anti DMRT2 pAb (ATL-HPA029297) at Atlas Antibodies |
Documents & Links for Anti DMRT2 pAb (ATL-HPA029297) | |
Datasheet | Anti DMRT2 pAb (ATL-HPA029297) Datasheet (External Link) |
Vendor Page | Anti DMRT2 pAb (ATL-HPA029297) |