Anti DMRT1 pAb (ATL-HPA027850 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA027850-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: doublesex and mab-3 related transcription factor 1
Gene Name: DMRT1
Alternative Gene Name: CT154, DMT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024837: 77%, ENSRNOG00000016075: 78%
Entrez Gene ID: 1761
Uniprot ID: Q9Y5R6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LAADSASGEVGNPLGGSPVKNSLRGLPGPYVPGQTGNQWQMKNMENRHAMSSQYRMHSYYPPPSYLGQSVPQFFTFEDAPSYPEARASVFSPPSSQDSGLVSLSSSSPISNKSTKAVLECEPASEPSSFTVTPVI
Gene Sequence LAADSASGEVGNPLGGSPVKNSLRGLPGPYVPGQTGNQWQMKNMENRHAMSSQYRMHSYYPPPSYLGQSVPQFFTFEDAPSYPEARASVFSPPSSQDSGLVSLSSSSPISNKSTKAVLECEPASEPSSFTVTPVI
Gene ID - Mouse ENSMUSG00000024837
Gene ID - Rat ENSRNOG00000016075
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DMRT1 pAb (ATL-HPA027850 w/enhanced validation)
Datasheet Anti DMRT1 pAb (ATL-HPA027850 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DMRT1 pAb (ATL-HPA027850 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DMRT1 pAb (ATL-HPA027850 w/enhanced validation)
Datasheet Anti DMRT1 pAb (ATL-HPA027850 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DMRT1 pAb (ATL-HPA027850 w/enhanced validation)
Citations for Anti DMRT1 pAb (ATL-HPA027850 w/enhanced validation) – 4 Found
von Kopylow, Kathrein; Staege, Hannah; Spiess, Andrej-Nikolai; Schulze, Wolfgang; Will, Hans; Primig, Michael; Kirchhoff, Christiane. Differential marker protein expression specifies rarefaction zone-containing human Adark spermatogonia. Reproduction (Cambridge, England). 2012;143(1):45-57.  PubMed
von Kopylow, Kathrein; Staege, Hannah; Schulze, Wolfgang; Will, Hans; Kirchhoff, Christiane. Fibroblast growth factor receptor 3 is highly expressed in rarely dividing human type A spermatogonia. Histochemistry And Cell Biology. 2012;138(5):759-72.  PubMed
Djureinovic, D; Fagerberg, L; Hallström, B; Danielsson, A; Lindskog, C; Uhlén, M; Pontén, F. The human testis-specific proteome defined by transcriptomics and antibody-based profiling. Molecular Human Reproduction. 2014;20(6):476-88.  PubMed
Richardson, Nainoa; Gillot, Isabelle; Gregoire, Elodie P; Youssef, Sameh A; de Rooij, Dirk; de Bruin, Alain; De Cian, Marie-Cécile; Chaboissier, Marie-Christine. Sox8 and Sox9 act redundantly for ovarian-to-testicular fate reprogramming in the absence of R-spondin1 in mouse sex reversals. Elife. 2020;9( 32450947)  PubMed