Anti DMP1 pAb (ATL-HPA037465)

Atlas Antibodies

Catalog No.: ATL-HPA037465-25

Protein Description: dentin matrix acidic phosphoprotein 1
Gene Name: DMP1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029307: 61%, ENSRNOG00000002167: 63%
Entrez Gene ID: 1758
Uniprot ID: Q13316
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QYIYRLAGGFSRSTGKGGDDKDDDEDDSGDDTFGDDDSGPGPKDRQEGGNSRLGSDEDSDDTIQASEESAPQGQDSAQDTTSE
• Gene Sequence: QYIYRLAGGFSRSTGKGGDDKDDDEDDSGDDTFGDDDSGPGPKDRQEGGNSRLGSDEDSDDTIQASEESAPQGQDSAQDTTSE
• Gene ID - Mouse: ENSMUSG00000029307
• Gene ID - Rat: ENSRNOG00000002167
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DMP1 pAb (ATL-HPA037465) – 2 Found

Verma, Manish; Callio, Jason; Otero, P Anthony; Sekler, Israel; Wills, Zachary P; Chu, Charleen T. Mitochondrial Calcium Dysregulation Contributes to Dendrite Degeneration Mediated by PD/LBD-Associated LRRK2 Mutants. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2017;37(46):11151-11165. 

Matsui, Mikiko; Kobayashi, Tomoko; Tsutsui, Takeo W. CD146 positive human dental pulp stem cells promote regeneration of dentin/pulp-like structures. Human Cell. 2018;31(2):127-138.