Anti DMBT1 pAb (ATL-HPA040778 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA040778-25

Protein Description: deleted in malignant brain tumors 1
Gene Name: DMBT1
Alternative Gene Name: GP340, muclin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047517: 71%, ENSRNOG00000020560: 71%
Entrez Gene ID: 1755
Uniprot ID: Q9UGM3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: STPAPFLNITRPNTDYSCGGFLSQPSGDFSSPFYPGNYPNNAKCVWDIEVQNNYRVTVIFRDVQLEGGCNYDYIEVFDGPYRSSPLIARVCDGAR
• Gene Sequence: STPAPFLNITRPNTDYSCGGFLSQPSGDFSSPFYPGNYPNNAKCVWDIEVQNNYRVTVIFRDVQLEGGCNYDYIEVFDGPYRSSPLIARVCDGAR
• Gene ID - Mouse: ENSMUSG00000047517
• Gene ID - Rat: ENSRNOG00000020560
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DMBT1 pAb (ATL-HPA040778 w/enhanced validation) – 1 Found

Pan, Xiaoyu; Zhang, Du; Nguyen, Duc Ninh; Wei, Wei; Yu, Xinxin; Gao, Fei; Sangild, Per T. Postnatal Gut Immunity and Microbiota Development Is Minimally Affected by Prenatal Inflammation in Preterm Pigs. Frontiers In Immunology. 11( 32265914):420.