Anti DLX6 pAb (ATL-HPA030608)

Atlas Antibodies

Catalog No.:
ATL-HPA030608-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: distal-less homeobox 6
Gene Name: DLX6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029754: 99%, ENSRNOG00000010822: 99%
Entrez Gene ID: 1750
Uniprot ID: P56179
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALPERAELAASLGLTQTQVKIWFQNKRSKFKKLLKQGSNPHESDPLQGSAALSPRSPALPPVWDVSASAKGVSMPPNSYMPGYSHWYSSPHQDTMQRPQMM
Gene Sequence ALPERAELAASLGLTQTQVKIWFQNKRSKFKKLLKQGSNPHESDPLQGSAALSPRSPALPPVWDVSASAKGVSMPPNSYMPGYSHWYSSPHQDTMQRPQMM
Gene ID - Mouse ENSMUSG00000029754
Gene ID - Rat ENSRNOG00000010822
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DLX6 pAb (ATL-HPA030608)
Datasheet Anti DLX6 pAb (ATL-HPA030608) Datasheet (External Link)
Vendor Page Anti DLX6 pAb (ATL-HPA030608) at Atlas Antibodies

Documents & Links for Anti DLX6 pAb (ATL-HPA030608)
Datasheet Anti DLX6 pAb (ATL-HPA030608) Datasheet (External Link)
Vendor Page Anti DLX6 pAb (ATL-HPA030608)