Anti DLX5 pAb (ATL-HPA005670)

Atlas Antibodies

SKU: ATL-HPA005670-25

• 
• 

Protein Description: distal-less homeobox 5
Gene Name: DLX5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029755: 93%, ENSRNOG00000010905: 92%
Entrez Gene ID: 1749
Uniprot ID: P56178
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHGYCSPTSASYGKALNPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNRVPSATNQPEKEVTEPEVRMVNGKPKKVRKP
• Gene Sequence: RRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHGYCSPTSASYGKALNPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNRVPSATNQPEKEVTEPEVRMVNGKPKKVRKP
• Gene ID - Mouse: ENSMUSG00000029755
• Gene ID - Rat: ENSRNOG00000010905
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DLX5 pAb (ATL-HPA005670) – 4 Found

Pebworth, Mark-Phillip; Ross, Jayden; Andrews, Madeline; Bhaduri, Aparna; Kriegstein, Arnold R. Human intermediate progenitor diversity during cortical development. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2021;118(26) 

Mullen, Rachel D; Bellessort, Brice; Levi, Giovanni; Behringer, Richard R. Distal-less homeobox genes Dlx5/6 regulate Müllerian duct regression. Frontiers In Endocrinology. 13( 35909540):916173. 

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. 

Marques, Felipe; Tenney, Jessica; Duran, Ivan; Martin, Jorge; Nevarez, Lisette; Pogue, Robert; Krakow, Deborah; Cohn, Daniel H; Li, Bing. Altered mRNA Splicing, Chondrocyte Gene Expression and Abnormal Skeletal Development due to SF3B4 Mutations in Rodriguez Acrofacial Dysostosis. Plos Genetics. 2016;12(9):e1006307.