Anti DLX2 pAb (ATL-HPA056965)

Atlas Antibodies

Catalog No.:
ATL-HPA056965-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: distal-less homeobox 2
Gene Name: DLX2
Alternative Gene Name: TES-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023391: 96%, ENSRNOG00000001519: 94%
Entrez Gene ID: 1746
Uniprot ID: Q07687
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RRSKFKKMWKSGEIPSEQHPGASASPPCASPPVSAPASWDFGVPQRM
Gene Sequence RRSKFKKMWKSGEIPSEQHPGASASPPCASPPVSAPASWDFGVPQRM
Gene ID - Mouse ENSMUSG00000023391
Gene ID - Rat ENSRNOG00000001519
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DLX2 pAb (ATL-HPA056965)
Datasheet Anti DLX2 pAb (ATL-HPA056965) Datasheet (External Link)
Vendor Page Anti DLX2 pAb (ATL-HPA056965) at Atlas Antibodies

Documents & Links for Anti DLX2 pAb (ATL-HPA056965)
Datasheet Anti DLX2 pAb (ATL-HPA056965) Datasheet (External Link)
Vendor Page Anti DLX2 pAb (ATL-HPA056965)