Anti DLST pAb (ATL-HPA003010 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA003010-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
Gene Name: DLST
Alternative Gene Name: DLTS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004789: 96%, ENSRNOG00000005061: 96%
Entrez Gene ID: 1743
Uniprot ID: P36957
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen QNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPII
Gene Sequence QNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPII
Gene ID - Mouse ENSMUSG00000004789
Gene ID - Rat ENSRNOG00000005061
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DLST pAb (ATL-HPA003010 w/enhanced validation)
Datasheet Anti DLST pAb (ATL-HPA003010 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DLST pAb (ATL-HPA003010 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DLST pAb (ATL-HPA003010 w/enhanced validation)
Datasheet Anti DLST pAb (ATL-HPA003010 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DLST pAb (ATL-HPA003010 w/enhanced validation)
Citations for Anti DLST pAb (ATL-HPA003010 w/enhanced validation) – 4 Found
Joseph, Sunil; Yuen, Alex; Singh, Vijender; Hmama, Zakaria. Mycobacterium tuberculosis Cpn60.2 (GroEL2) blocks macrophage apoptosis via interaction with mitochondrial mortalin. Biology Open. 2017;6(4):481-488.  PubMed
Remacha, Laura; Pirman, David; Mahoney, Christopher E; Coloma, Javier; Calsina, Bruna; Currás-Freixes, Maria; Letón, Rocío; Torres-Pérez, Rafael; Richter, Susan; Pita, Guillermo; Herráez, Belén; Cianchetta, Giovanni; Honrado, Emiliano; Maestre, Lorena; Urioste, Miguel; Aller, Javier; García-Uriarte, Óscar; Gálvez, María Ángeles; Luque, Raúl M; Lahera, Marcos; Moreno-Rengel, Cristina; Eisenhofer, Graeme; Montero-Conde, Cristina; Rodríguez-Antona, Cristina; Llorca, Óscar; Smolen, Gromoslaw A; Robledo, Mercedes; Cascón, Alberto. Recurrent Germline DLST Mutations in Individuals with Multiple Pheochromocytomas and Paragangliomas. American Journal Of Human Genetics. 2019;104(4):651-664.  PubMed
Dobolyi, Arpad; Bago, Attila; Palkovits, Miklos; Nemeria, Natalia S; Jordan, Frank; Doczi, Judit; Ambrus, Attila; Adam-Vizi, Vera; Chinopoulos, Christos. Exclusive neuronal detection of KGDHC-specific subunits in the adult human brain cortex despite pancellular protein lysine succinylation. Brain Structure & Function. 2020;225(2):639-667.  PubMed
Yap, Zheng Yie; Strucinska, Klaudia; Matsuzaki, Satoshi; Lee, Sukyeong; Si, Yue; Humphries, Kenneth; Tarnopolsky, Mark A; Yoon, Wan Hee. A biallelic pathogenic variant in the OGDH gene results in a neurological disorder with features of a mitochondrial disease. Journal Of Inherited Metabolic Disease. 2021;44(2):388-400.  PubMed