Anti DLL4 pAb (ATL-HPA023392)

Atlas Antibodies

Catalog No.:
ATL-HPA023392-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: delta-like 4 (Drosophila)
Gene Name: DLL4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027314: 84%, ENSRNOG00000014011: 84%
Entrez Gene ID: 54567
Uniprot ID: Q9NR61
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CHDLENGLMCTCPAGFSGRRCEVRTSIDACASSPCFNRATCYTDLSTDTFVCNCPYGFVGSRCEFPVGL
Gene Sequence CHDLENGLMCTCPAGFSGRRCEVRTSIDACASSPCFNRATCYTDLSTDTFVCNCPYGFVGSRCEFPVGL
Gene ID - Mouse ENSMUSG00000027314
Gene ID - Rat ENSRNOG00000014011
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DLL4 pAb (ATL-HPA023392)
Datasheet Anti DLL4 pAb (ATL-HPA023392) Datasheet (External Link)
Vendor Page Anti DLL4 pAb (ATL-HPA023392) at Atlas Antibodies

Documents & Links for Anti DLL4 pAb (ATL-HPA023392)
Datasheet Anti DLL4 pAb (ATL-HPA023392) Datasheet (External Link)
Vendor Page Anti DLL4 pAb (ATL-HPA023392)
Citations for Anti DLL4 pAb (ATL-HPA023392) – 2 Found
Kim, Youjin; Byeon, Sun-Ju; Hur, Joonyoung; Lee, Kangkook; Kim, Dongin; Ahn, Jin-Hyung; Lee, Sang Hoon; You, Weon-Kyoo; Kim, Seung Tae; Park, Se Hoon; Kang, Won Ki; Kim, Kyoung-Mee; Lee, Jeeyun. High delta-like ligand 4 expression correlates with a poor clinical outcome in gastric cancer. Journal Of Cancer. 10(14):3172-3178.  PubMed
Vo, Kevin; Amarasinghe, Barushi; Washington, Kay; Gonzalez, Adriana; Berlin, Jordan; Dang, Thao P. Targeting notch pathway enhances rapamycin antitumor activity in pancreas cancers through PTEN phosphorylation. Molecular Cancer. 2011;10( 22074495):138.  PubMed