Anti DLK2 pAb (ATL-HPA068672)
Atlas Antibodies
- Catalog No.:
- ATL-HPA068672-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DLK2
Alternative Gene Name: EGFL9, MGC2487
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047428: 96%, ENSRNOG00000018949: 96%
Entrez Gene ID: 65989
Uniprot ID: Q6UY11
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TCHQPWQCICHSGWAGKFCDKDEHICTTQSPCQNGGQCMYDGGGEYHCV |
| Gene Sequence | TCHQPWQCICHSGWAGKFCDKDEHICTTQSPCQNGGQCMYDGGGEYHCV |
| Gene ID - Mouse | ENSMUSG00000047428 |
| Gene ID - Rat | ENSRNOG00000018949 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DLK2 pAb (ATL-HPA068672) | |
| Datasheet | Anti DLK2 pAb (ATL-HPA068672) Datasheet (External Link) |
| Vendor Page | Anti DLK2 pAb (ATL-HPA068672) at Atlas Antibodies |
| Documents & Links for Anti DLK2 pAb (ATL-HPA068672) | |
| Datasheet | Anti DLK2 pAb (ATL-HPA068672) Datasheet (External Link) |
| Vendor Page | Anti DLK2 pAb (ATL-HPA068672) |