Anti DLGAP5 pAb (ATL-HPA005546 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA005546-25

Protein Description: discs, large (Drosophila) homolog-associated protein 5
Gene Name: DLGAP5
Alternative Gene Name: DLG1, DLG7, HURP, KIAA0008
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037544: 73%, ENSRNOG00000010721: 68%
Entrez Gene ID: 9787
Uniprot ID: Q15398
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ASRHRKDISTEMIRTKIAHRKSLSQKENRHKEYERNRHFGLKDVNIPTLEGRILVELDETSQGLVPEKTNVKPRAMKTILGDQRKQMLQKYKEEKQLQKLKEQREKAKRGIFKVGRYRPDMPCFLLSNQNAVKAE
• Gene Sequence: ASRHRKDISTEMIRTKIAHRKSLSQKENRHKEYERNRHFGLKDVNIPTLEGRILVELDETSQGLVPEKTNVKPRAMKTILGDQRKQMLQKYKEEKQLQKLKEQREKAKRGIFKVGRYRPDMPCFLLSNQNAVKAE
• Gene ID - Mouse: ENSMUSG00000037544
• Gene ID - Rat: ENSRNOG00000010721
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DLGAP5 pAb (ATL-HPA005546 w/enhanced validation) – 1 Found

Hewit, Kay; Sandilands, Emma; Martinez, Rafael Sanchez; James, Daniel; Leung, Hing Y; Bryant, David M; Shanks, Emma; Markert, Elke K. A functional genomics screen reveals a strong synergistic effect between docetaxel and the mitotic gene DLGAP5 that is mediated by the androgen receptor. Cell Death & Disease. 2018;9(11):1069.