Anti DLGAP5 pAb (ATL-HPA005546 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA005546-25
  • Immunohistochemistry analysis in human testis and liver tissues using HPA005546 antibody. Corresponding DLGAP5 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line A-431 shows localization to cytosol & microtubule organizing center.
  • Western blot analysis in human cell lines U2OS and SK-MEL-30 using Anti-DLGAP5 antibody. Corresponding DLGAP5 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: discs, large (Drosophila) homolog-associated protein 5
Gene Name: DLGAP5
Alternative Gene Name: DLG1, DLG7, HURP, KIAA0008
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037544: 73%, ENSRNOG00000010721: 68%
Entrez Gene ID: 9787
Uniprot ID: Q15398
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ASRHRKDISTEMIRTKIAHRKSLSQKENRHKEYERNRHFGLKDVNIPTLEGRILVELDETSQGLVPEKTNVKPRAMKTILGDQRKQMLQKYKEEKQLQKLKEQREKAKRGIFKVGRYRPDMPCFLLSNQNAVKAE
Gene Sequence ASRHRKDISTEMIRTKIAHRKSLSQKENRHKEYERNRHFGLKDVNIPTLEGRILVELDETSQGLVPEKTNVKPRAMKTILGDQRKQMLQKYKEEKQLQKLKEQREKAKRGIFKVGRYRPDMPCFLLSNQNAVKAE
Gene ID - Mouse ENSMUSG00000037544
Gene ID - Rat ENSRNOG00000010721
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DLGAP5 pAb (ATL-HPA005546 w/enhanced validation)
Datasheet Anti DLGAP5 pAb (ATL-HPA005546 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DLGAP5 pAb (ATL-HPA005546 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DLGAP5 pAb (ATL-HPA005546 w/enhanced validation)
Datasheet Anti DLGAP5 pAb (ATL-HPA005546 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DLGAP5 pAb (ATL-HPA005546 w/enhanced validation)



Citations for Anti DLGAP5 pAb (ATL-HPA005546 w/enhanced validation) – 1 Found
Hewit, Kay; Sandilands, Emma; Martinez, Rafael Sanchez; James, Daniel; Leung, Hing Y; Bryant, David M; Shanks, Emma; Markert, Elke K. A functional genomics screen reveals a strong synergistic effect between docetaxel and the mitotic gene DLGAP5 that is mediated by the androgen receptor. Cell Death & Disease. 2018;9(11):1069.  PubMed
!