Anti DLGAP3 pAb (ATL-HPA027304)

Atlas Antibodies

Catalog No.: ATL-HPA027304-25

Protein Description: DLG associated protein 3
Gene Name: DLGAP3
Alternative Gene Name: DAP3, SAPAP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042388: 92%, ENSRNOG00000014302: 92%
Entrez Gene ID: 58512
Uniprot ID: O95886
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PKTSPKAVARRFTTRRSSSVDQARINCCVPPRIHPRSSIPGYSRSLTTGQLSDELNQQLEAVCGSVFGELES
• Gene Sequence: PKTSPKAVARRFTTRRSSSVDQARINCCVPPRIHPRSSIPGYSRSLTTGQLSDELNQQLEAVCGSVFGELES
• Gene ID - Mouse: ENSMUSG00000042388
• Gene ID - Rat: ENSRNOG00000014302
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.