Anti DLGAP3 pAb (ATL-HPA027304)

Atlas Antibodies

Catalog No.:
ATL-HPA027304-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: DLG associated protein 3
Gene Name: DLGAP3
Alternative Gene Name: DAP3, SAPAP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042388: 92%, ENSRNOG00000014302: 92%
Entrez Gene ID: 58512
Uniprot ID: O95886
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PKTSPKAVARRFTTRRSSSVDQARINCCVPPRIHPRSSIPGYSRSLTTGQLSDELNQQLEAVCGSVFGELES
Gene Sequence PKTSPKAVARRFTTRRSSSVDQARINCCVPPRIHPRSSIPGYSRSLTTGQLSDELNQQLEAVCGSVFGELES
Gene ID - Mouse ENSMUSG00000042388
Gene ID - Rat ENSRNOG00000014302
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DLGAP3 pAb (ATL-HPA027304)
Datasheet Anti DLGAP3 pAb (ATL-HPA027304) Datasheet (External Link)
Vendor Page Anti DLGAP3 pAb (ATL-HPA027304) at Atlas Antibodies

Documents & Links for Anti DLGAP3 pAb (ATL-HPA027304)
Datasheet Anti DLGAP3 pAb (ATL-HPA027304) Datasheet (External Link)
Vendor Page Anti DLGAP3 pAb (ATL-HPA027304)