Anti DLG5 pAb (ATL-HPA001746)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001746-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: DLG5
Alternative Gene Name: KIAA0583, P-dlg
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021782: 76%, ENSRNOG00000005783: 73%
Entrez Gene ID: 9231
Uniprot ID: Q8TDM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FLHKPFPGGPLQVCPQACPSASERSLSSFRSDASGDRGFGLVDVRGRRPLLPFETEVGPCGVGEASLDKADSEGSNSGGTWPKAMLSSTAVPEKLSVYKKPKQRKSI |
Gene Sequence | FLHKPFPGGPLQVCPQACPSASERSLSSFRSDASGDRGFGLVDVRGRRPLLPFETEVGPCGVGEASLDKADSEGSNSGGTWPKAMLSSTAVPEKLSVYKKPKQRKSI |
Gene ID - Mouse | ENSMUSG00000021782 |
Gene ID - Rat | ENSRNOG00000005783 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DLG5 pAb (ATL-HPA001746) | |
Datasheet | Anti DLG5 pAb (ATL-HPA001746) Datasheet (External Link) |
Vendor Page | Anti DLG5 pAb (ATL-HPA001746) at Atlas Antibodies |
Documents & Links for Anti DLG5 pAb (ATL-HPA001746) | |
Datasheet | Anti DLG5 pAb (ATL-HPA001746) Datasheet (External Link) |
Vendor Page | Anti DLG5 pAb (ATL-HPA001746) |