Anti DLG5 pAb (ATL-HPA001746)

Atlas Antibodies

Catalog No.:
ATL-HPA001746-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: discs, large homolog 5 (Drosophila)
Gene Name: DLG5
Alternative Gene Name: KIAA0583, P-dlg
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021782: 76%, ENSRNOG00000005783: 73%
Entrez Gene ID: 9231
Uniprot ID: Q8TDM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FLHKPFPGGPLQVCPQACPSASERSLSSFRSDASGDRGFGLVDVRGRRPLLPFETEVGPCGVGEASLDKADSEGSNSGGTWPKAMLSSTAVPEKLSVYKKPKQRKSI
Gene Sequence FLHKPFPGGPLQVCPQACPSASERSLSSFRSDASGDRGFGLVDVRGRRPLLPFETEVGPCGVGEASLDKADSEGSNSGGTWPKAMLSSTAVPEKLSVYKKPKQRKSI
Gene ID - Mouse ENSMUSG00000021782
Gene ID - Rat ENSRNOG00000005783
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DLG5 pAb (ATL-HPA001746)
Datasheet Anti DLG5 pAb (ATL-HPA001746) Datasheet (External Link)
Vendor Page Anti DLG5 pAb (ATL-HPA001746) at Atlas Antibodies

Documents & Links for Anti DLG5 pAb (ATL-HPA001746)
Datasheet Anti DLG5 pAb (ATL-HPA001746) Datasheet (External Link)
Vendor Page Anti DLG5 pAb (ATL-HPA001746)