Anti DLG5 pAb (ATL-HPA001746)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001746-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: DLG5
Alternative Gene Name: KIAA0583, P-dlg
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021782: 76%, ENSRNOG00000005783: 73%
Entrez Gene ID: 9231
Uniprot ID: Q8TDM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FLHKPFPGGPLQVCPQACPSASERSLSSFRSDASGDRGFGLVDVRGRRPLLPFETEVGPCGVGEASLDKADSEGSNSGGTWPKAMLSSTAVPEKLSVYKKPKQRKSI |
| Gene Sequence | FLHKPFPGGPLQVCPQACPSASERSLSSFRSDASGDRGFGLVDVRGRRPLLPFETEVGPCGVGEASLDKADSEGSNSGGTWPKAMLSSTAVPEKLSVYKKPKQRKSI |
| Gene ID - Mouse | ENSMUSG00000021782 |
| Gene ID - Rat | ENSRNOG00000005783 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DLG5 pAb (ATL-HPA001746) | |
| Datasheet | Anti DLG5 pAb (ATL-HPA001746) Datasheet (External Link) |
| Vendor Page | Anti DLG5 pAb (ATL-HPA001746) at Atlas Antibodies |
| Documents & Links for Anti DLG5 pAb (ATL-HPA001746) | |
| Datasheet | Anti DLG5 pAb (ATL-HPA001746) Datasheet (External Link) |
| Vendor Page | Anti DLG5 pAb (ATL-HPA001746) |