Anti DLG4 pAb (ATL-HPA010122 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA010122-25

Protein Description: discs, large homolog 4 (Drosophila)
Gene Name: DLG4
Alternative Gene Name: PSD-95, PSD95, SAP-90, SAP90
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020886: 99%, ENSRNOG00000018526: 99%
Entrez Gene ID: 1742
Uniprot ID: P78352
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYAR
• Gene Sequence: HDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYAR
• Gene ID - Mouse: ENSMUSG00000020886
• Gene ID - Rat: ENSRNOG00000018526
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DLG4 pAb (ATL-HPA010122 w/enhanced validation) – 2 Found

Fourie, C; Kim, E; Waldvogel, H; Wong, J M; McGregor, A; Faull, R L M; Montgomery, J M. Differential Changes in Postsynaptic Density Proteins in Postmortem Huntington's Disease and Parkinson's Disease Human Brains. Journal Of Neurodegenerative Diseases. 2014( 26317010):938530. 

Martinez De La Cruz, Braulio; Markus, Robert; Malla, Sunir; Haig, Maria Isabel; Gell, Chris; Sang, Fei; Bellows, Eleanor; Sherif, Mahmoud Awad; McLean, Denise; Lourdusamy, Anbarasu; Self, Tim; Bodi, Zsuzsanna; Smith, Stuart; Fay, Michael; Macdonald, Ian A; Fray, Rupert; Knight, Helen Miranda. Modifying the m(6)A brain methylome by ALKBH5-mediated demethylation: a new contender for synaptic tagging. Molecular Psychiatry. 2021;26(12):7141-7153.