Anti DLG4 pAb (ATL-HPA010122 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA010122-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: DLG4
Alternative Gene Name: PSD-95, PSD95, SAP-90, SAP90
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020886: 99%, ENSRNOG00000018526: 99%
Entrez Gene ID: 1742
Uniprot ID: P78352
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYAR |
Gene Sequence | HDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYAR |
Gene ID - Mouse | ENSMUSG00000020886 |
Gene ID - Rat | ENSRNOG00000018526 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DLG4 pAb (ATL-HPA010122 w/enhanced validation) | |
Datasheet | Anti DLG4 pAb (ATL-HPA010122 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DLG4 pAb (ATL-HPA010122 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti DLG4 pAb (ATL-HPA010122 w/enhanced validation) | |
Datasheet | Anti DLG4 pAb (ATL-HPA010122 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DLG4 pAb (ATL-HPA010122 w/enhanced validation) |
Citations for Anti DLG4 pAb (ATL-HPA010122 w/enhanced validation) – 2 Found |
Fourie, C; Kim, E; Waldvogel, H; Wong, J M; McGregor, A; Faull, R L M; Montgomery, J M. Differential Changes in Postsynaptic Density Proteins in Postmortem Huntington's Disease and Parkinson's Disease Human Brains. Journal Of Neurodegenerative Diseases. 2014( 26317010):938530. PubMed |
Martinez De La Cruz, Braulio; Markus, Robert; Malla, Sunir; Haig, Maria Isabel; Gell, Chris; Sang, Fei; Bellows, Eleanor; Sherif, Mahmoud Awad; McLean, Denise; Lourdusamy, Anbarasu; Self, Tim; Bodi, Zsuzsanna; Smith, Stuart; Fay, Michael; Macdonald, Ian A; Fray, Rupert; Knight, Helen Miranda. Modifying the m(6)A brain methylome by ALKBH5-mediated demethylation: a new contender for synaptic tagging. Molecular Psychiatry. 2021;26(12):7141-7153. PubMed |