Anti DLG2 pAb (ATL-HPA023896)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023896-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: DLG2
Alternative Gene Name: chapsyn-110, PPP1R58, PSD-93, PSD93
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052572: 82%, ENSRNOG00000038597: 52%
Entrez Gene ID: 1740
Uniprot ID: Q15700
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ETDETTTKYRYQDEDAPHDHSLPRLTHEVRGPELVHVSEKNLSQI |
Gene Sequence | ETDETTTKYRYQDEDAPHDHSLPRLTHEVRGPELVHVSEKNLSQI |
Gene ID - Mouse | ENSMUSG00000052572 |
Gene ID - Rat | ENSRNOG00000038597 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DLG2 pAb (ATL-HPA023896) | |
Datasheet | Anti DLG2 pAb (ATL-HPA023896) Datasheet (External Link) |
Vendor Page | Anti DLG2 pAb (ATL-HPA023896) at Atlas Antibodies |
Documents & Links for Anti DLG2 pAb (ATL-HPA023896) | |
Datasheet | Anti DLG2 pAb (ATL-HPA023896) Datasheet (External Link) |
Vendor Page | Anti DLG2 pAb (ATL-HPA023896) |