Anti DLG2 pAb (ATL-HPA023896)

Atlas Antibodies

Catalog No.:
ATL-HPA023896-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: discs, large homolog 2 (Drosophila)
Gene Name: DLG2
Alternative Gene Name: chapsyn-110, PPP1R58, PSD-93, PSD93
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052572: 82%, ENSRNOG00000038597: 52%
Entrez Gene ID: 1740
Uniprot ID: Q15700
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ETDETTTKYRYQDEDAPHDHSLPRLTHEVRGPELVHVSEKNLSQI
Gene Sequence ETDETTTKYRYQDEDAPHDHSLPRLTHEVRGPELVHVSEKNLSQI
Gene ID - Mouse ENSMUSG00000052572
Gene ID - Rat ENSRNOG00000038597
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DLG2 pAb (ATL-HPA023896)
Datasheet Anti DLG2 pAb (ATL-HPA023896) Datasheet (External Link)
Vendor Page Anti DLG2 pAb (ATL-HPA023896) at Atlas Antibodies

Documents & Links for Anti DLG2 pAb (ATL-HPA023896)
Datasheet Anti DLG2 pAb (ATL-HPA023896) Datasheet (External Link)
Vendor Page Anti DLG2 pAb (ATL-HPA023896)