Anti DLG2 pAb (ATL-HPA023896)

Atlas Antibodies

Catalog No.: ATL-HPA023896-25

Protein Description: discs, large homolog 2 (Drosophila)
Gene Name: DLG2
Alternative Gene Name: chapsyn-110, PPP1R58, PSD-93, PSD93
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052572: 82%, ENSRNOG00000038597: 52%
Entrez Gene ID: 1740
Uniprot ID: Q15700
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ETDETTTKYRYQDEDAPHDHSLPRLTHEVRGPELVHVSEKNLSQI
• Gene Sequence: ETDETTTKYRYQDEDAPHDHSLPRLTHEVRGPELVHVSEKNLSQI
• Gene ID - Mouse: ENSMUSG00000052572
• Gene ID - Rat: ENSRNOG00000038597
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.