Anti DLEC1 pAb (ATL-HPA019077 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA019077-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: DLEC1
Alternative Gene Name: CFAP81, DLC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038060: 58%, ENSRNOG00000032085: 56%
Entrez Gene ID: 9940
Uniprot ID: Q9Y238
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PPVKSVSRWCIDSELLRKHHLISPEDYYTDTVPFHSAPKGISLPGCSKLTFSCEKRSVQKKELNKKLEDSCRKKLAEFEDELDHTVDSLTWNLTPKAKERTREPLKKASQPRN |
| Gene Sequence | PPVKSVSRWCIDSELLRKHHLISPEDYYTDTVPFHSAPKGISLPGCSKLTFSCEKRSVQKKELNKKLEDSCRKKLAEFEDELDHTVDSLTWNLTPKAKERTREPLKKASQPRN |
| Gene ID - Mouse | ENSMUSG00000038060 |
| Gene ID - Rat | ENSRNOG00000032085 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DLEC1 pAb (ATL-HPA019077 w/enhanced validation) | |
| Datasheet | Anti DLEC1 pAb (ATL-HPA019077 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DLEC1 pAb (ATL-HPA019077 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti DLEC1 pAb (ATL-HPA019077 w/enhanced validation) | |
| Datasheet | Anti DLEC1 pAb (ATL-HPA019077 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DLEC1 pAb (ATL-HPA019077 w/enhanced validation) |
| Citations for Anti DLEC1 pAb (ATL-HPA019077 w/enhanced validation) – 2 Found |
| Li, Lili; Xu, Juan; Qiu, Guohua; Ying, Jianming; Du, Zhenfang; Xiang, Tingxiu; Wong, Kai Yau; Srivastava, Gopesh; Zhu, Xiao-Feng; Mok, Tony S; Chan, Anthony Tc; Chan, Francis Kl; Ambinder, Richard F; Tao, Qian. Epigenomic characterization of a p53-regulated 3p22.2 tumor suppressor that inhibits STAT3 phosphorylation via protein docking and is frequently methylated in esophageal and other carcinomas. Theranostics. 8(1):61-77. PubMed |
| Qiu, Guo-Hua; Xie, Xiaojin; Deng, Linhong; Hooi, Shing Chuan. Tumor Suppressor DLEC1 can Stimulate the Proliferation of Cancer Cells When AP-2ɑ2 is Down-Regulated in HCT116. Hepatitis Monthly. 2015;15(11):e29829. PubMed |