Anti DLEC1 pAb (ATL-HPA019077 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA019077-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: deleted in lung and esophageal cancer 1
Gene Name: DLEC1
Alternative Gene Name: CFAP81, DLC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038060: 58%, ENSRNOG00000032085: 56%
Entrez Gene ID: 9940
Uniprot ID: Q9Y238
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PPVKSVSRWCIDSELLRKHHLISPEDYYTDTVPFHSAPKGISLPGCSKLTFSCEKRSVQKKELNKKLEDSCRKKLAEFEDELDHTVDSLTWNLTPKAKERTREPLKKASQPRN
Gene Sequence PPVKSVSRWCIDSELLRKHHLISPEDYYTDTVPFHSAPKGISLPGCSKLTFSCEKRSVQKKELNKKLEDSCRKKLAEFEDELDHTVDSLTWNLTPKAKERTREPLKKASQPRN
Gene ID - Mouse ENSMUSG00000038060
Gene ID - Rat ENSRNOG00000032085
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DLEC1 pAb (ATL-HPA019077 w/enhanced validation)
Datasheet Anti DLEC1 pAb (ATL-HPA019077 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DLEC1 pAb (ATL-HPA019077 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DLEC1 pAb (ATL-HPA019077 w/enhanced validation)
Datasheet Anti DLEC1 pAb (ATL-HPA019077 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DLEC1 pAb (ATL-HPA019077 w/enhanced validation)
Citations for Anti DLEC1 pAb (ATL-HPA019077 w/enhanced validation) – 2 Found
Li, Lili; Xu, Juan; Qiu, Guohua; Ying, Jianming; Du, Zhenfang; Xiang, Tingxiu; Wong, Kai Yau; Srivastava, Gopesh; Zhu, Xiao-Feng; Mok, Tony S; Chan, Anthony Tc; Chan, Francis Kl; Ambinder, Richard F; Tao, Qian. Epigenomic characterization of a p53-regulated 3p22.2 tumor suppressor that inhibits STAT3 phosphorylation via protein docking and is frequently methylated in esophageal and other carcinomas. Theranostics. 8(1):61-77.  PubMed
Qiu, Guo-Hua; Xie, Xiaojin; Deng, Linhong; Hooi, Shing Chuan. Tumor Suppressor DLEC1 can Stimulate the Proliferation of Cancer Cells When AP-2ɑ2 is Down-Regulated in HCT116. Hepatitis Monthly. 2015;15(11):e29829.  PubMed