Anti DLD pAb (ATL-HPA044849)

Atlas Antibodies

Catalog No.:
ATL-HPA044849-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: dihydrolipoamide dehydrogenase
Gene Name: DLD
Alternative Gene Name: DLDH, GCSL, LAD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020664: 98%, ENSRNOG00000006364: 98%
Entrez Gene ID: 1738
Uniprot ID: P09622
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DVVAGPMLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVK
Gene Sequence DVVAGPMLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVK
Gene ID - Mouse ENSMUSG00000020664
Gene ID - Rat ENSRNOG00000006364
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DLD pAb (ATL-HPA044849)
Datasheet Anti DLD pAb (ATL-HPA044849) Datasheet (External Link)
Vendor Page Anti DLD pAb (ATL-HPA044849) at Atlas Antibodies

Documents & Links for Anti DLD pAb (ATL-HPA044849)
Datasheet Anti DLD pAb (ATL-HPA044849) Datasheet (External Link)
Vendor Page Anti DLD pAb (ATL-HPA044849)
Citations for Anti DLD pAb (ATL-HPA044849) – 1 Found
Dobolyi, Arpad; Bago, Attila; Palkovits, Miklos; Nemeria, Natalia S; Jordan, Frank; Doczi, Judit; Ambrus, Attila; Adam-Vizi, Vera; Chinopoulos, Christos. Exclusive neuronal detection of KGDHC-specific subunits in the adult human brain cortex despite pancellular protein lysine succinylation. Brain Structure & Function. 2020;225(2):639-667.  PubMed