Anti DLC1 pAb (ATL-HPA017753)
Atlas Antibodies
- Catalog No.:
- ATL-HPA017753-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: DLC1
Alternative Gene Name: ARHGAP7, DLC-1, HP, p122-RhoGAP, STARD12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031523: 68%, ENSRNOG00000043053: 22%
Entrez Gene ID: 10395
Uniprot ID: Q96QB1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RSWEEHVTHWMGQPFNSDDRNTACHHGLVADSLQASMEKDATLNVDRKEKCVSLPDCCHGSELRDFPGRPMGHLSKDVDENDSHEGEDQFLSLEASTETLVHVSDEDNNADLCLTDDKQVLNTQGQ |
| Gene Sequence | RSWEEHVTHWMGQPFNSDDRNTACHHGLVADSLQASMEKDATLNVDRKEKCVSLPDCCHGSELRDFPGRPMGHLSKDVDENDSHEGEDQFLSLEASTETLVHVSDEDNNADLCLTDDKQVLNTQGQ |
| Gene ID - Mouse | ENSMUSG00000031523 |
| Gene ID - Rat | ENSRNOG00000043053 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DLC1 pAb (ATL-HPA017753) | |
| Datasheet | Anti DLC1 pAb (ATL-HPA017753) Datasheet (External Link) |
| Vendor Page | Anti DLC1 pAb (ATL-HPA017753) at Atlas Antibodies |
| Documents & Links for Anti DLC1 pAb (ATL-HPA017753) | |
| Datasheet | Anti DLC1 pAb (ATL-HPA017753) Datasheet (External Link) |
| Vendor Page | Anti DLC1 pAb (ATL-HPA017753) |
| Citations for Anti DLC1 pAb (ATL-HPA017753) – 2 Found |
| Muehlich, S; Hampl, V; Khalid, S; Singer, S; Frank, N; Breuhahn, K; Gudermann, T; Prywes, R. The transcriptional coactivators megakaryoblastic leukemia 1/2 mediate the effects of loss of the tumor suppressor deleted in liver cancer 1. Oncogene. 2012;31(35):3913-23. PubMed |
| Goeppert, Benjamin; Ernst, Christina; Baer, Constance; Roessler, Stephanie; Renner, Marcus; Mehrabi, Arianeb; Hafezi, Mohammadreza; Pathil, Anita; Warth, Arne; Stenzinger, Albrecht; Weichert, Wilko; Bähr, Marion; Will, Rainer; Schirmacher, Peter; Plass, Christoph; Weichenhan, Dieter. Cadherin-6 is a putative tumor suppressor and target of epigenetically dysregulated miR-429 in cholangiocarcinoma. Epigenetics. 2016;11(11):780-790. PubMed |