Anti DLC1 pAb (ATL-HPA017753)

Atlas Antibodies

Catalog No.:
ATL-HPA017753-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: DLC1 Rho GTPase activating protein
Gene Name: DLC1
Alternative Gene Name: ARHGAP7, DLC-1, HP, p122-RhoGAP, STARD12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031523: 68%, ENSRNOG00000043053: 22%
Entrez Gene ID: 10395
Uniprot ID: Q96QB1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RSWEEHVTHWMGQPFNSDDRNTACHHGLVADSLQASMEKDATLNVDRKEKCVSLPDCCHGSELRDFPGRPMGHLSKDVDENDSHEGEDQFLSLEASTETLVHVSDEDNNADLCLTDDKQVLNTQGQ
Gene Sequence RSWEEHVTHWMGQPFNSDDRNTACHHGLVADSLQASMEKDATLNVDRKEKCVSLPDCCHGSELRDFPGRPMGHLSKDVDENDSHEGEDQFLSLEASTETLVHVSDEDNNADLCLTDDKQVLNTQGQ
Gene ID - Mouse ENSMUSG00000031523
Gene ID - Rat ENSRNOG00000043053
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DLC1 pAb (ATL-HPA017753)
Datasheet Anti DLC1 pAb (ATL-HPA017753) Datasheet (External Link)
Vendor Page Anti DLC1 pAb (ATL-HPA017753) at Atlas Antibodies

Documents & Links for Anti DLC1 pAb (ATL-HPA017753)
Datasheet Anti DLC1 pAb (ATL-HPA017753) Datasheet (External Link)
Vendor Page Anti DLC1 pAb (ATL-HPA017753)
Citations for Anti DLC1 pAb (ATL-HPA017753) – 2 Found
Muehlich, S; Hampl, V; Khalid, S; Singer, S; Frank, N; Breuhahn, K; Gudermann, T; Prywes, R. The transcriptional coactivators megakaryoblastic leukemia 1/2 mediate the effects of loss of the tumor suppressor deleted in liver cancer 1. Oncogene. 2012;31(35):3913-23.  PubMed
Goeppert, Benjamin; Ernst, Christina; Baer, Constance; Roessler, Stephanie; Renner, Marcus; Mehrabi, Arianeb; Hafezi, Mohammadreza; Pathil, Anita; Warth, Arne; Stenzinger, Albrecht; Weichert, Wilko; Bähr, Marion; Will, Rainer; Schirmacher, Peter; Plass, Christoph; Weichenhan, Dieter. Cadherin-6 is a putative tumor suppressor and target of epigenetically dysregulated miR-429 in cholangiocarcinoma. Epigenetics. 2016;11(11):780-790.  PubMed