Anti DLAT pAb (ATL-HPA040786 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA040786-25
  • Immunohistochemistry analysis in human heart muscle and liver tissues using Anti-DLAT antibody. Corresponding DLAT RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
  • Western blot analysis using Anti-DLAT antibody HPA040786 (A) shows similar pattern to independent antibody HPA062766 (B).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: dihydrolipoamide S-acetyltransferase
Gene Name: DLAT
Alternative Gene Name: DLTA, PDC-E2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000168: 91%, ENSRNOG00000009994: 93%
Entrez Gene ID: 1737
Uniprot ID: P10515
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADISAFADYRPTEVTDLKPQVPPPT
Gene Sequence LLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADISAFADYRPTEVTDLKPQVPPPT
Gene ID - Mouse ENSMUSG00000000168
Gene ID - Rat ENSRNOG00000009994
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DLAT pAb (ATL-HPA040786 w/enhanced validation)
Datasheet Anti DLAT pAb (ATL-HPA040786 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DLAT pAb (ATL-HPA040786 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DLAT pAb (ATL-HPA040786 w/enhanced validation)
Datasheet Anti DLAT pAb (ATL-HPA040786 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DLAT pAb (ATL-HPA040786 w/enhanced validation)