Anti DKK3 pAb (ATL-HPA011868 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA011868-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: DKK3
Alternative Gene Name: REIC, RIG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030772: 83%, ENSRNOG00000016343: 81%
Entrez Gene ID: 27122
Uniprot ID: Q9UBP4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | CGDQLCVWGHCTKMATRGSNGTICDNQRDCQPGLCCAFQRGLLFPVCTPLPVEGELCHDPASRLLDLITWELEPDGALDRCPCASGLLCQPHSHSLVYVCKPTFVGSRDQDGEILLPREVPDEYLAASW |
| Gene Sequence | CGDQLCVWGHCTKMATRGSNGTICDNQRDCQPGLCCAFQRGLLFPVCTPLPVEGELCHDPASRLLDLITWELEPDGALDRCPCASGLLCQPHSHSLVYVCKPTFVGSRDQDGEILLPREVPDEYLAASW |
| Gene ID - Mouse | ENSMUSG00000030772 |
| Gene ID - Rat | ENSRNOG00000016343 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DKK3 pAb (ATL-HPA011868 w/enhanced validation) | |
| Datasheet | Anti DKK3 pAb (ATL-HPA011868 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DKK3 pAb (ATL-HPA011868 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti DKK3 pAb (ATL-HPA011868 w/enhanced validation) | |
| Datasheet | Anti DKK3 pAb (ATL-HPA011868 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DKK3 pAb (ATL-HPA011868 w/enhanced validation) |
| Citations for Anti DKK3 pAb (ATL-HPA011868 w/enhanced validation) – 2 Found |
| Ferrari, Nicola; Ranftl, Romana; Chicherova, Ievgeniia; Slaven, Neil D; Moeendarbary, Emad; Farrugia, Aaron J; Lam, Maxine; Semiannikova, Maria; Westergaard, Marie C W; Tchou, Julia; Magnani, Luca; Calvo, Fernando. Dickkopf-3 links HSF1 and YAP/TAZ signalling to control aggressive behaviours in cancer-associated fibroblasts. Nature Communications. 2019;10(1):130. PubMed |
| Rivellese, Felice; Surace, Anna E A; Goldmann, Katriona; Sciacca, Elisabetta; Çubuk, Cankut; Giorli, Giovanni; John, Christopher R; Nerviani, Alessandra; Fossati-Jimack, Liliane; Thorborn, Georgina; Ahmed, Manzoor; Prediletto, Edoardo; Church, Sarah E; Hudson, Briana M; Warren, Sarah E; McKeigue, Paul M; Humby, Frances; Bombardieri, Michele; Barnes, Michael R; Lewis, Myles J; Pitzalis, Costantino. Rituximab versus tocilizumab in rheumatoid arthritis: synovial biopsy-based biomarker analysis of the phase 4 R4RA randomized trial. Nature Medicine. 2022;28(6):1256-1268. PubMed |