Anti DKK2 pAb (ATL-HPA052611)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052611-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: DKK2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028031: 95%, ENSRNOG00000011360: 95%
Entrez Gene ID: 27123
Uniprot ID: Q9UBU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MCCPSTRCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEGDPCLRSSDCIEGFCC |
Gene Sequence | MCCPSTRCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEGDPCLRSSDCIEGFCC |
Gene ID - Mouse | ENSMUSG00000028031 |
Gene ID - Rat | ENSRNOG00000011360 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DKK2 pAb (ATL-HPA052611) | |
Datasheet | Anti DKK2 pAb (ATL-HPA052611) Datasheet (External Link) |
Vendor Page | Anti DKK2 pAb (ATL-HPA052611) at Atlas Antibodies |
Documents & Links for Anti DKK2 pAb (ATL-HPA052611) | |
Datasheet | Anti DKK2 pAb (ATL-HPA052611) Datasheet (External Link) |
Vendor Page | Anti DKK2 pAb (ATL-HPA052611) |