Anti DKC1 pAb (ATL-HPA000447)

Atlas Antibodies

SKU: ATL-HPA000447-25

• 

Protein Description: dyskeratosis congenita 1, dyskerin
Gene Name: DKC1
Alternative Gene Name: DKC, dyskerin, NAP57, NOLA4, XAP101
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031403: 94%, ENSRNOG00000055562: 86%
Entrez Gene ID: 1736
Uniprot ID: O60832
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KERKSLPEEDVAEIQHAEEFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIGDYIRTGFINLDKPSNPSSHEVVAWIRRILRVEKTGHSGTL
• Gene Sequence: KERKSLPEEDVAEIQHAEEFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIGDYIRTGFINLDKPSNPSSHEVVAWIRRILRVEKTGHSGTL
• Gene ID - Mouse: ENSMUSG00000031403
• Gene ID - Rat: ENSRNOG00000055562
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DKC1 pAb (ATL-HPA000447) – 2 Found

Bolander, Asa; Agnarsdóttir, Margrét; Strömberg, Sara; Ponten, Fredrik; Hesselius, Patrik; Uhlen, Mathias; Bergqvist, Michael. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics & Proteomics. 2008;5(6):293-300. 

von Stedingk, Kristoffer; Koster, Jan; Piqueras, Marta; Noguera, Rosa; Navarro, Samuel; Påhlman, Sven; Versteeg, Rogier; Ora, Ingrid; Gisselsson, David; Lindgren, David; Axelson, Håkan. snoRNPs Regulate Telomerase Activity in Neuroblastoma and Are Associated with Poor Prognosis. Translational Oncology. 2013;6(4):447-57.