Anti DKC1 pAb (ATL-HPA000166)

Atlas Antibodies

Catalog No.:
ATL-HPA000166-100
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: dyskeratosis congenita 1, dyskerin
Gene Name: DKC1
Alternative Gene Name: DKC, dyskerin, NAP57, NOLA4, XAP101
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031403: 99%, ENSRNOG00000055562: 92%
Entrez Gene ID: 1736
Uniprot ID: O60832
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EAGTYIRTLCVHLGLLLGVGGQMQELRRVRSGVMSEKDHMVTMHDVLDAQWLYDNHKDESYLRRVVYPLEKLLTSHKRLVMKDSAVNAICYGAKIMLPGVLRYEDGIEVNQEIVVIT
Gene Sequence EAGTYIRTLCVHLGLLLGVGGQMQELRRVRSGVMSEKDHMVTMHDVLDAQWLYDNHKDESYLRRVVYPLEKLLTSHKRLVMKDSAVNAICYGAKIMLPGVLRYEDGIEVNQEIVVIT
Gene ID - Mouse ENSMUSG00000031403
Gene ID - Rat ENSRNOG00000055562
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DKC1 pAb (ATL-HPA000166)
Datasheet Anti DKC1 pAb (ATL-HPA000166) Datasheet (External Link)
Vendor Page Anti DKC1 pAb (ATL-HPA000166) at Atlas Antibodies

Documents & Links for Anti DKC1 pAb (ATL-HPA000166)
Datasheet Anti DKC1 pAb (ATL-HPA000166) Datasheet (External Link)
Vendor Page Anti DKC1 pAb (ATL-HPA000166)
Citations for Anti DKC1 pAb (ATL-HPA000166) – 4 Found
Montanaro, Lorenzo; Calienni, Maria; Ceccarelli, Claudio; Santini, Donatella; Taffurelli, Mario; Pileri, Stefano; Treré, Davide; Derenzini, Massimo. Relationship between dyskerin expression and telomerase activity in human breast cancer. Cellular Oncology : The Official Journal Of The International Society For Cellular Oncology. 30(6):483-90.  PubMed
Sieron, P; Hader, C; Hatina, J; Engers, R; Wlazlinski, A; Müller, M; Schulz, W A. DKC1 overexpression associated with prostate cancer progression. British Journal Of Cancer. 2009;101(8):1410-6.  PubMed
Koskimaa, Hanna-Mari; Kurvinen, Kaisa; Costa, Silvano; Syrjänen, Kari; Syrjänen, Stina. Molecular markers implicating early malignant events in cervical carcinogenesis. Cancer Epidemiology, Biomarkers & Prevention : A Publication Of The American Association For Cancer Research, Cosponsored By The American Society Of Preventive Oncology. 2010;19(8):2003-12.  PubMed
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed