Anti DKC1 pAb (ATL-HPA000166)

Atlas Antibodies

SKU: ATL-HPA000166-100

• 
• 

Protein Description: dyskeratosis congenita 1, dyskerin
Gene Name: DKC1
Alternative Gene Name: DKC, dyskerin, NAP57, NOLA4, XAP101
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031403: 99%, ENSRNOG00000055562: 92%
Entrez Gene ID: 1736
Uniprot ID: O60832
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EAGTYIRTLCVHLGLLLGVGGQMQELRRVRSGVMSEKDHMVTMHDVLDAQWLYDNHKDESYLRRVVYPLEKLLTSHKRLVMKDSAVNAICYGAKIMLPGVLRYEDGIEVNQEIVVIT
• Gene Sequence: EAGTYIRTLCVHLGLLLGVGGQMQELRRVRSGVMSEKDHMVTMHDVLDAQWLYDNHKDESYLRRVVYPLEKLLTSHKRLVMKDSAVNAICYGAKIMLPGVLRYEDGIEVNQEIVVIT
• Gene ID - Mouse: ENSMUSG00000031403
• Gene ID - Rat: ENSRNOG00000055562
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DKC1 pAb (ATL-HPA000166) – 4 Found

Montanaro, Lorenzo; Calienni, Maria; Ceccarelli, Claudio; Santini, Donatella; Taffurelli, Mario; Pileri, Stefano; Treré, Davide; Derenzini, Massimo. Relationship between dyskerin expression and telomerase activity in human breast cancer. Cellular Oncology : The Official Journal Of The International Society For Cellular Oncology. 30(6):483-90. 

Sieron, P; Hader, C; Hatina, J; Engers, R; Wlazlinski, A; Müller, M; Schulz, W A. DKC1 overexpression associated with prostate cancer progression. British Journal Of Cancer. 2009;101(8):1410-6. 

Koskimaa, Hanna-Mari; Kurvinen, Kaisa; Costa, Silvano; Syrjänen, Kari; Syrjänen, Stina. Molecular markers implicating early malignant events in cervical carcinogenesis. Cancer Epidemiology, Biomarkers & Prevention : A Publication Of The American Association For Cancer Research, Cosponsored By The American Society Of Preventive Oncology. 2010;19(8):2003-12. 

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.