Anti DIS3L2 pAb (ATL-HPA035796)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035796-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: DIS3L2
Alternative Gene Name: FAM6A, FLJ36974, MGC42174
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053333: 76%, ENSRNOG00000018931: 75%
Entrez Gene ID: 129563
Uniprot ID: Q8IYB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RNRALNGDLVVVKLLPEEHWKVVKPESNDKETEAAYESDIPEELCGHHLPQQSLKSYNDSPDVIVEAQFDGSDSEDGHGITQNVLVDGVKKLS |
| Gene Sequence | RNRALNGDLVVVKLLPEEHWKVVKPESNDKETEAAYESDIPEELCGHHLPQQSLKSYNDSPDVIVEAQFDGSDSEDGHGITQNVLVDGVKKLS |
| Gene ID - Mouse | ENSMUSG00000053333 |
| Gene ID - Rat | ENSRNOG00000018931 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DIS3L2 pAb (ATL-HPA035796) | |
| Datasheet | Anti DIS3L2 pAb (ATL-HPA035796) Datasheet (External Link) |
| Vendor Page | Anti DIS3L2 pAb (ATL-HPA035796) at Atlas Antibodies |
| Documents & Links for Anti DIS3L2 pAb (ATL-HPA035796) | |
| Datasheet | Anti DIS3L2 pAb (ATL-HPA035796) Datasheet (External Link) |
| Vendor Page | Anti DIS3L2 pAb (ATL-HPA035796) |
| Citations for Anti DIS3L2 pAb (ATL-HPA035796) – 1 Found |
| Kurosaki, Tatsuaki; Miyoshi, Keita; Myers, Jason R; Maquat, Lynne E. NMD-degradome sequencing reveals ribosome-bound intermediates with 3'-end non-templated nucleotides. Nature Structural & Molecular Biology. 2018;25(10):940-950. PubMed |