Anti DIS3L2 pAb (ATL-HPA035796)

Atlas Antibodies

SKU: ATL-HPA035796-25

• 
• 

Protein Description: DIS3 like 3'-5' exoribonuclease 2
Gene Name: DIS3L2
Alternative Gene Name: FAM6A, FLJ36974, MGC42174
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053333: 76%, ENSRNOG00000018931: 75%
Entrez Gene ID: 129563
Uniprot ID: Q8IYB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RNRALNGDLVVVKLLPEEHWKVVKPESNDKETEAAYESDIPEELCGHHLPQQSLKSYNDSPDVIVEAQFDGSDSEDGHGITQNVLVDGVKKLS
• Gene Sequence: RNRALNGDLVVVKLLPEEHWKVVKPESNDKETEAAYESDIPEELCGHHLPQQSLKSYNDSPDVIVEAQFDGSDSEDGHGITQNVLVDGVKKLS
• Gene ID - Mouse: ENSMUSG00000053333
• Gene ID - Rat: ENSRNOG00000018931
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DIS3L2 pAb (ATL-HPA035796) – 1 Found

Kurosaki, Tatsuaki; Miyoshi, Keita; Myers, Jason R; Maquat, Lynne E. NMD-degradome sequencing reveals ribosome-bound intermediates with 3'-end non-templated nucleotides. Nature Structural & Molecular Biology. 2018;25(10):940-950.