Anti DIS3L pAb (ATL-HPA041805)

Atlas Antibodies

SKU: ATL-HPA041805-25

• 
• 

Protein Description: DIS3 like exosome 3'-5' exoribonuclease
Gene Name: DIS3L
Alternative Gene Name: DIS3L1, FLJ38088, KIAA1955, MGC4562
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032396: 91%, ENSRNOG00000010537: 93%
Entrez Gene ID: 115752
Uniprot ID: Q8TF46
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LRNLLKDARHDCILFANEFQQCCYLPRERGESMEKWQTRSIYNAAVWYYHHCQDRMPIVMVTEDEEAIQQYGSETEGVFVITFKNYLDNFWPDLKAAHE
• Gene Sequence: LRNLLKDARHDCILFANEFQQCCYLPRERGESMEKWQTRSIYNAAVWYYHHCQDRMPIVMVTEDEEAIQQYGSETEGVFVITFKNYLDNFWPDLKAAHE
• Gene ID - Mouse: ENSMUSG00000032396
• Gene ID - Rat: ENSRNOG00000010537
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DIS3L pAb (ATL-HPA041805) – 3 Found

Kalisiak, Katarzyna; Kuliński, Tomasz M; Tomecki, Rafał; Cysewski, Dominik; Pietras, Zbigniew; Chlebowski, Aleksander; Kowalska, Katarzyna; Dziembowski, Andrzej. A short splicing isoform of HBS1L links the cytoplasmic exosome and SKI complexes in humans. Nucleic Acids Research. 2017;45(4):2068-2080. 

Tomecki, Rafal; Drazkowska, Karolina; Kucinski, Iwo; Stodus, Krystian; Szczesny, Roman J; Gruchota, Jakub; Owczarek, Ewelina P; Kalisiak, Katarzyna; Dziembowski, Andrzej. Multiple myeloma-associated hDIS3 mutations cause perturbations in cellular RNA metabolism and suggest hDIS3 PIN domain as a potential drug target. Nucleic Acids Research. 2014;42(2):1270-90. 

Kurosaki, Tatsuaki; Miyoshi, Keita; Myers, Jason R; Maquat, Lynne E. NMD-degradome sequencing reveals ribosome-bound intermediates with 3'-end non-templated nucleotides. Nature Structural & Molecular Biology. 2018;25(10):940-950.