Anti DIS3 pAb (ATL-HPA039281 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA039281-25

• 
• 
• 

Protein Description: DIS3 exosome endoribonuclease and 3'-5' exoribonuclease
Gene Name: DIS3
Alternative Gene Name: dis3p, EXOSC11, KIAA1008, RRP44
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033166: 86%, ENSRNOG00000009125: 87%
Entrez Gene ID: 22894
Uniprot ID: Q9Y2L1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EAYILFVRKNAIVVLIPKYGLEGTVFFEEKDKPNPQLIYDDEIPSLKIEDTVFHVFDKVKVKIMLDSSNLQHQKIRMSLVEPQIPGISIPTDTSN
• Gene Sequence: EAYILFVRKNAIVVLIPKYGLEGTVFFEEKDKPNPQLIYDDEIPSLKIEDTVFHVFDKVKVKIMLDSSNLQHQKIRMSLVEPQIPGISIPTDTSN
• Gene ID - Mouse: ENSMUSG00000033166
• Gene ID - Rat: ENSRNOG00000009125
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DIS3 pAb (ATL-HPA039281 w/enhanced validation) – 3 Found

Tomecki, Rafal; Drazkowska, Karolina; Kucinski, Iwo; Stodus, Krystian; Szczesny, Roman J; Gruchota, Jakub; Owczarek, Ewelina P; Kalisiak, Katarzyna; Dziembowski, Andrzej. Multiple myeloma-associated hDIS3 mutations cause perturbations in cellular RNA metabolism and suggest hDIS3 PIN domain as a potential drug target. Nucleic Acids Research. 2014;42(2):1270-90. 

Garland, William; Comet, Itys; Wu, Mengjun; Radzisheuskaya, Aliaksandra; Rib, Leonor; Vitting-Seerup, Kristoffer; Lloret-Llinares, Marta; Sandelin, Albin; Helin, Kristian; Jensen, Torben Heick. A Functional Link between Nuclear RNA Decay and Transcriptional Control Mediated by the Polycomb Repressive Complex 2. Cell Reports. 2019;29(7):1800-1811.e6. 

Green, Immanuel D; Pinello, Natalia; Song, Renhua; Lee, Quintin; Halstead, James M; Kwok, Chau-To; Wong, Alex C H; Nair, Shalima S; Clark, Susan J; Roediger, Ben; Schmitz, Ulf; Larance, Mark; Hayashi, Rippei; Rasko, John E J; Wong, Justin J-L. Macrophage development and activation involve coordinated intron retention in key inflammatory regulators. Nucleic Acids Research. 2020;48(12):6513-6529.