Anti DIRC2 pAb (ATL-HPA072579)

Atlas Antibodies

SKU: ATL-HPA072579-25

• 

Protein Description: disrupted in renal carcinoma 2
Gene Name: DIRC2
Alternative Gene Name: FLJ14784, RCC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022848: 92%, ENSRNOG00000002240: 92%
Entrez Gene ID: 84925
Uniprot ID: Q96SL1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IPISDLILKRRLIHGGQMLNGLAGPTVMNAAPFLSTTWFSADERATATAIAS
• Gene Sequence: IPISDLILKRRLIHGGQMLNGLAGPTVMNAAPFLSTTWFSADERATATAIAS
• Gene ID - Mouse: ENSMUSG00000022848
• Gene ID - Rat: ENSRNOG00000002240
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.