Anti DIRC2 pAb (ATL-HPA072579)

Atlas Antibodies

Catalog No.:
ATL-HPA072579-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: disrupted in renal carcinoma 2
Gene Name: DIRC2
Alternative Gene Name: FLJ14784, RCC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022848: 92%, ENSRNOG00000002240: 92%
Entrez Gene ID: 84925
Uniprot ID: Q96SL1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IPISDLILKRRLIHGGQMLNGLAGPTVMNAAPFLSTTWFSADERATATAIAS
Gene Sequence IPISDLILKRRLIHGGQMLNGLAGPTVMNAAPFLSTTWFSADERATATAIAS
Gene ID - Mouse ENSMUSG00000022848
Gene ID - Rat ENSRNOG00000002240
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DIRC2 pAb (ATL-HPA072579)
Datasheet Anti DIRC2 pAb (ATL-HPA072579) Datasheet (External Link)
Vendor Page Anti DIRC2 pAb (ATL-HPA072579) at Atlas Antibodies

Documents & Links for Anti DIRC2 pAb (ATL-HPA072579)
Datasheet Anti DIRC2 pAb (ATL-HPA072579) Datasheet (External Link)
Vendor Page Anti DIRC2 pAb (ATL-HPA072579)