Anti DIRC2 pAb (ATL-HPA072579)
Atlas Antibodies
- Catalog No.:
- ATL-HPA072579-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: DIRC2
Alternative Gene Name: FLJ14784, RCC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022848: 92%, ENSRNOG00000002240: 92%
Entrez Gene ID: 84925
Uniprot ID: Q96SL1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IPISDLILKRRLIHGGQMLNGLAGPTVMNAAPFLSTTWFSADERATATAIAS |
| Gene Sequence | IPISDLILKRRLIHGGQMLNGLAGPTVMNAAPFLSTTWFSADERATATAIAS |
| Gene ID - Mouse | ENSMUSG00000022848 |
| Gene ID - Rat | ENSRNOG00000002240 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DIRC2 pAb (ATL-HPA072579) | |
| Datasheet | Anti DIRC2 pAb (ATL-HPA072579) Datasheet (External Link) |
| Vendor Page | Anti DIRC2 pAb (ATL-HPA072579) at Atlas Antibodies |
| Documents & Links for Anti DIRC2 pAb (ATL-HPA072579) | |
| Datasheet | Anti DIRC2 pAb (ATL-HPA072579) Datasheet (External Link) |
| Vendor Page | Anti DIRC2 pAb (ATL-HPA072579) |