Anti DIRC1 pAb (ATL-HPA068508)
Atlas Antibodies
- Catalog No.:
- ATL-HPA068508-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: DIRC1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005583: 32%, ENSRNOG00000033134: 32%
Entrez Gene ID: 116093
Uniprot ID: Q969H9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EPSIISDTCFYKPITKDQLSSRSELNTVRLKCLNSLRGWKILNQLS |
| Gene Sequence | EPSIISDTCFYKPITKDQLSSRSELNTVRLKCLNSLRGWKILNQLS |
| Gene ID - Mouse | ENSMUSG00000005583 |
| Gene ID - Rat | ENSRNOG00000033134 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DIRC1 pAb (ATL-HPA068508) | |
| Datasheet | Anti DIRC1 pAb (ATL-HPA068508) Datasheet (External Link) |
| Vendor Page | Anti DIRC1 pAb (ATL-HPA068508) at Atlas Antibodies |
| Documents & Links for Anti DIRC1 pAb (ATL-HPA068508) | |
| Datasheet | Anti DIRC1 pAb (ATL-HPA068508) Datasheet (External Link) |
| Vendor Page | Anti DIRC1 pAb (ATL-HPA068508) |