Anti DIRC1 pAb (ATL-HPA068508)

Atlas Antibodies

Catalog No.:
ATL-HPA068508-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: disrupted in renal carcinoma 1
Gene Name: DIRC1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005583: 32%, ENSRNOG00000033134: 32%
Entrez Gene ID: 116093
Uniprot ID: Q969H9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EPSIISDTCFYKPITKDQLSSRSELNTVRLKCLNSLRGWKILNQLS
Gene Sequence EPSIISDTCFYKPITKDQLSSRSELNTVRLKCLNSLRGWKILNQLS
Gene ID - Mouse ENSMUSG00000005583
Gene ID - Rat ENSRNOG00000033134
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DIRC1 pAb (ATL-HPA068508)
Datasheet Anti DIRC1 pAb (ATL-HPA068508) Datasheet (External Link)
Vendor Page Anti DIRC1 pAb (ATL-HPA068508) at Atlas Antibodies

Documents & Links for Anti DIRC1 pAb (ATL-HPA068508)
Datasheet Anti DIRC1 pAb (ATL-HPA068508) Datasheet (External Link)
Vendor Page Anti DIRC1 pAb (ATL-HPA068508)