Anti DIRAS3 pAb (ATL-HPA029384)

Atlas Antibodies

Catalog No.: ATL-HPA029384-25

Protein Description: DIRAS family, GTP-binding RAS-like 3
Gene Name: DIRAS3
Alternative Gene Name: ARHI, NOEY2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047842: 44%, ENSRNOG00000032328: 44%
Entrez Gene ID: 9077
Uniprot ID: O95661
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGNNLHKF
• Gene Sequence: YCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGNNLHKF
• Gene ID - Mouse: ENSMUSG00000047842
• Gene ID - Rat: ENSRNOG00000032328
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DIRAS3 pAb (ATL-HPA029384) – 1 Found

Qiu, Jingping; Li, Xiaoting; He, Yingjian; Sun, Dan; Li, Wenhui; Xin, Yan. Distinct subgroup of the Ras family member 3 (DIRAS3) expression impairs metastasis and induces autophagy of gastric cancer cells in mice. Journal Of Cancer Research And Clinical Oncology. 2018;144(10):1869-1886.