Anti DIRAS3 pAb (ATL-HPA029384)
Atlas Antibodies
- SKU:
- ATL-HPA029384-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DIRAS3
Alternative Gene Name: ARHI, NOEY2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047842: 44%, ENSRNOG00000032328: 44%
Entrez Gene ID: 9077
Uniprot ID: O95661
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGNNLHKF |
| Gene Sequence | YCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGNNLHKF |
| Gene ID - Mouse | ENSMUSG00000047842 |
| Gene ID - Rat | ENSRNOG00000032328 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DIRAS3 pAb (ATL-HPA029384) | |
| Datasheet | Anti DIRAS3 pAb (ATL-HPA029384) Datasheet (External Link) |
| Vendor Page | Anti DIRAS3 pAb (ATL-HPA029384) at Atlas Antibodies |
| Documents & Links for Anti DIRAS3 pAb (ATL-HPA029384) | |
| Datasheet | Anti DIRAS3 pAb (ATL-HPA029384) Datasheet (External Link) |
| Vendor Page | Anti DIRAS3 pAb (ATL-HPA029384) |
| Citations for Anti DIRAS3 pAb (ATL-HPA029384) – 1 Found |
| Qiu, Jingping; Li, Xiaoting; He, Yingjian; Sun, Dan; Li, Wenhui; Xin, Yan. Distinct subgroup of the Ras family member 3 (DIRAS3) expression impairs metastasis and induces autophagy of gastric cancer cells in mice. Journal Of Cancer Research And Clinical Oncology. 2018;144(10):1869-1886. PubMed |