Anti DIP2C pAb (ATL-HPA059325)

Atlas Antibodies

Catalog No.:
ATL-HPA059325-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: disco-interacting protein 2 homolog C
Gene Name: DIP2C
Alternative Gene Name: KIAA0934
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048264: 100%, ENSRNOG00000015288: 68%
Entrez Gene ID: 22982
Uniprot ID: Q9Y2E4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KKRSKLIGAYLPQPPRVDQALPQERRAPVTPSSASRYHRRRSSGSRDERY
Gene Sequence KKRSKLIGAYLPQPPRVDQALPQERRAPVTPSSASRYHRRRSSGSRDERY
Gene ID - Mouse ENSMUSG00000048264
Gene ID - Rat ENSRNOG00000015288
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DIP2C pAb (ATL-HPA059325)
Datasheet Anti DIP2C pAb (ATL-HPA059325) Datasheet (External Link)
Vendor Page Anti DIP2C pAb (ATL-HPA059325) at Atlas Antibodies

Documents & Links for Anti DIP2C pAb (ATL-HPA059325)
Datasheet Anti DIP2C pAb (ATL-HPA059325) Datasheet (External Link)
Vendor Page Anti DIP2C pAb (ATL-HPA059325)