Anti DIP2B pAb (ATL-HPA046133)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046133-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: DIP2B
Alternative Gene Name: FLJ34278, KIAA1463
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023026: 91%, ENSRNOG00000056106: 91%
Entrez Gene ID: 57609
Uniprot ID: Q9P265
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EKKRSKLLSPYSPQTQETDSAVQKELRNQTPAPSAAQTSAPSKYHRTRSGGARDERY |
| Gene Sequence | EKKRSKLLSPYSPQTQETDSAVQKELRNQTPAPSAAQTSAPSKYHRTRSGGARDERY |
| Gene ID - Mouse | ENSMUSG00000023026 |
| Gene ID - Rat | ENSRNOG00000056106 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DIP2B pAb (ATL-HPA046133) | |
| Datasheet | Anti DIP2B pAb (ATL-HPA046133) Datasheet (External Link) |
| Vendor Page | Anti DIP2B pAb (ATL-HPA046133) at Atlas Antibodies |
| Documents & Links for Anti DIP2B pAb (ATL-HPA046133) | |
| Datasheet | Anti DIP2B pAb (ATL-HPA046133) Datasheet (External Link) |
| Vendor Page | Anti DIP2B pAb (ATL-HPA046133) |
| Citations for Anti DIP2B pAb (ATL-HPA046133) – 1 Found |
| Xing, Zhen-Kai; Zhang, Lu-Qing; Zhang, Yu; Sun, Xue; Sun, Xiao-Lin; Yu, Hua-Li; Zheng, Yao-Wu; He, Zi-Xuan; Zhu, Xiao-Juan. DIP2B Interacts With α-Tubulin to Regulate Axon Outgrowth. Frontiers In Cellular Neuroscience. 14( 32153366):29. PubMed |