Anti DIP2B pAb (ATL-HPA038472)

Atlas Antibodies

Catalog No.: ATL-HPA038472-25

Protein Description: disco-interacting protein 2 homolog B
Gene Name: DIP2B
Alternative Gene Name: FLJ34278, KIAA1463
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023026: 91%, ENSRNOG00000056106: 91%
Entrez Gene ID: 57609
Uniprot ID: Q9P265
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EKKRSKLLSPYSPQTQETDSAVQKELRNQTPAPSAAQTSAPSKYHRTRSGGARDERY
• Gene Sequence: EKKRSKLLSPYSPQTQETDSAVQKELRNQTPAPSAAQTSAPSKYHRTRSGGARDERY
• Gene ID - Mouse: ENSMUSG00000023026
• Gene ID - Rat: ENSRNOG00000056106
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.