Anti DIP2B pAb (ATL-HPA038472)

Atlas Antibodies

Catalog No.:
ATL-HPA038472-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: disco-interacting protein 2 homolog B
Gene Name: DIP2B
Alternative Gene Name: FLJ34278, KIAA1463
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023026: 91%, ENSRNOG00000056106: 91%
Entrez Gene ID: 57609
Uniprot ID: Q9P265
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EKKRSKLLSPYSPQTQETDSAVQKELRNQTPAPSAAQTSAPSKYHRTRSGGARDERY
Gene Sequence EKKRSKLLSPYSPQTQETDSAVQKELRNQTPAPSAAQTSAPSKYHRTRSGGARDERY
Gene ID - Mouse ENSMUSG00000023026
Gene ID - Rat ENSRNOG00000056106
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DIP2B pAb (ATL-HPA038472)
Datasheet Anti DIP2B pAb (ATL-HPA038472) Datasheet (External Link)
Vendor Page Anti DIP2B pAb (ATL-HPA038472) at Atlas Antibodies

Documents & Links for Anti DIP2B pAb (ATL-HPA038472)
Datasheet Anti DIP2B pAb (ATL-HPA038472) Datasheet (External Link)
Vendor Page Anti DIP2B pAb (ATL-HPA038472)