Anti DIP2A pAb (ATL-HPA052516)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052516-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DIP2A
Alternative Gene Name: C21orf106, Dip2, KIAA0184
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020231: 79%, ENSRNOG00000043212: 63%
Entrez Gene ID: 23181
Uniprot ID: Q14689
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RAKLLARYIPLIQGIDPSLQAENRIPGPSQTTAAAPKQQKSRPTASRDERFRS |
| Gene Sequence | RAKLLARYIPLIQGIDPSLQAENRIPGPSQTTAAAPKQQKSRPTASRDERFRS |
| Gene ID - Mouse | ENSMUSG00000020231 |
| Gene ID - Rat | ENSRNOG00000043212 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DIP2A pAb (ATL-HPA052516) | |
| Datasheet | Anti DIP2A pAb (ATL-HPA052516) Datasheet (External Link) |
| Vendor Page | Anti DIP2A pAb (ATL-HPA052516) at Atlas Antibodies |
| Documents & Links for Anti DIP2A pAb (ATL-HPA052516) | |
| Datasheet | Anti DIP2A pAb (ATL-HPA052516) Datasheet (External Link) |
| Vendor Page | Anti DIP2A pAb (ATL-HPA052516) |