Anti DIP2A pAb (ATL-HPA052516)

Atlas Antibodies

Catalog No.:
ATL-HPA052516-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: DIP2 disco-interacting protein 2 homolog A (Drosophila)
Gene Name: DIP2A
Alternative Gene Name: C21orf106, Dip2, KIAA0184
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020231: 79%, ENSRNOG00000043212: 63%
Entrez Gene ID: 23181
Uniprot ID: Q14689
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RAKLLARYIPLIQGIDPSLQAENRIPGPSQTTAAAPKQQKSRPTASRDERFRS
Gene Sequence RAKLLARYIPLIQGIDPSLQAENRIPGPSQTTAAAPKQQKSRPTASRDERFRS
Gene ID - Mouse ENSMUSG00000020231
Gene ID - Rat ENSRNOG00000043212
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DIP2A pAb (ATL-HPA052516)
Datasheet Anti DIP2A pAb (ATL-HPA052516) Datasheet (External Link)
Vendor Page Anti DIP2A pAb (ATL-HPA052516) at Atlas Antibodies

Documents & Links for Anti DIP2A pAb (ATL-HPA052516)
Datasheet Anti DIP2A pAb (ATL-HPA052516) Datasheet (External Link)
Vendor Page Anti DIP2A pAb (ATL-HPA052516)