Anti DIMT1 pAb (ATL-HPA042944)

Atlas Antibodies

SKU: ATL-HPA042944-25

• 
• 
• 

Protein Description: DIM1 dimethyladenosine transferase 1 homolog (S. cerevisiae)
Gene Name: DIMT1
Alternative Gene Name: DIMT1L, HSA9761
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021692: 96%, ENSRNOG00000013596: 96%
Entrez Gene ID: 27292
Uniprot ID: Q9UNQ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GGLMFNTGIGQHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAELHKRVQGTPVASKLQVLVGDVLKTDLPFFDTCV
• Gene Sequence: GGLMFNTGIGQHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAELHKRVQGTPVASKLQVLVGDVLKTDLPFFDTCV
• Gene ID - Mouse: ENSMUSG00000021692
• Gene ID - Rat: ENSRNOG00000013596
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DIMT1 pAb (ATL-HPA042944) – 2 Found

Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24. 

Zhou, Hai-Zhen; Chen, Bo; Li, Xiao-Ju; Du, Juan-Juan; Zhang, Nan; Shao, Yu-Xiong; Zhang, Kun; Tong, Zhi-Chao. MicroRNA-545-5p regulates apoptosis, migration and invasion of osteosarcoma by targeting dimethyladenosine transferase 1. Oncology Letters. 2021;22(5):763.