Anti DIMT1 pAb (ATL-HPA042944)

Atlas Antibodies

Catalog No.:
ATL-HPA042944-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: DIM1 dimethyladenosine transferase 1 homolog (S. cerevisiae)
Gene Name: DIMT1
Alternative Gene Name: DIMT1L, HSA9761
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021692: 96%, ENSRNOG00000013596: 96%
Entrez Gene ID: 27292
Uniprot ID: Q9UNQ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GGLMFNTGIGQHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAELHKRVQGTPVASKLQVLVGDVLKTDLPFFDTCV
Gene Sequence GGLMFNTGIGQHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAELHKRVQGTPVASKLQVLVGDVLKTDLPFFDTCV
Gene ID - Mouse ENSMUSG00000021692
Gene ID - Rat ENSRNOG00000013596
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DIMT1 pAb (ATL-HPA042944)
Datasheet Anti DIMT1 pAb (ATL-HPA042944) Datasheet (External Link)
Vendor Page Anti DIMT1 pAb (ATL-HPA042944) at Atlas Antibodies

Documents & Links for Anti DIMT1 pAb (ATL-HPA042944)
Datasheet Anti DIMT1 pAb (ATL-HPA042944) Datasheet (External Link)
Vendor Page Anti DIMT1 pAb (ATL-HPA042944)
Citations for Anti DIMT1 pAb (ATL-HPA042944) – 2 Found
Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24.  PubMed
Zhou, Hai-Zhen; Chen, Bo; Li, Xiao-Ju; Du, Juan-Juan; Zhang, Nan; Shao, Yu-Xiong; Zhang, Kun; Tong, Zhi-Chao. MicroRNA-545-5p regulates apoptosis, migration and invasion of osteosarcoma by targeting dimethyladenosine transferase 1. Oncology Letters. 2021;22(5):763.  PubMed