Anti DIMT1 pAb (ATL-HPA042944)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042944-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: DIMT1
Alternative Gene Name: DIMT1L, HSA9761
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021692: 96%, ENSRNOG00000013596: 96%
Entrez Gene ID: 27292
Uniprot ID: Q9UNQ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GGLMFNTGIGQHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAELHKRVQGTPVASKLQVLVGDVLKTDLPFFDTCV |
Gene Sequence | GGLMFNTGIGQHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAELHKRVQGTPVASKLQVLVGDVLKTDLPFFDTCV |
Gene ID - Mouse | ENSMUSG00000021692 |
Gene ID - Rat | ENSRNOG00000013596 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DIMT1 pAb (ATL-HPA042944) | |
Datasheet | Anti DIMT1 pAb (ATL-HPA042944) Datasheet (External Link) |
Vendor Page | Anti DIMT1 pAb (ATL-HPA042944) at Atlas Antibodies |
Documents & Links for Anti DIMT1 pAb (ATL-HPA042944) | |
Datasheet | Anti DIMT1 pAb (ATL-HPA042944) Datasheet (External Link) |
Vendor Page | Anti DIMT1 pAb (ATL-HPA042944) |
Citations for Anti DIMT1 pAb (ATL-HPA042944) – 2 Found |
Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24. PubMed |
Zhou, Hai-Zhen; Chen, Bo; Li, Xiao-Ju; Du, Juan-Juan; Zhang, Nan; Shao, Yu-Xiong; Zhang, Kun; Tong, Zhi-Chao. MicroRNA-545-5p regulates apoptosis, migration and invasion of osteosarcoma by targeting dimethyladenosine transferase 1. Oncology Letters. 2021;22(5):763. PubMed |