Anti DIEXF pAb (ATL-HPA026640)

Atlas Antibodies

Catalog No.:
ATL-HPA026640-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: digestive organ expansion factor homolog (zebrafish)
Gene Name: DIEXF
Alternative Gene Name: C1orf107, DEF, MGC29875, UTP25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016181: 93%, ENSRNOG00000004789: 94%
Entrez Gene ID: 27042
Uniprot ID: Q68CQ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLPLDSHGVDFSRVRMWSLNNWSKYYRQTLLFGALQDAQINSVFNKYCVNMQGQVAVRNVPMTGSISHVLVQLPHVFQRMEAENLASVIDARFNFFVNKILPQYRDAVM
Gene Sequence LLPLDSHGVDFSRVRMWSLNNWSKYYRQTLLFGALQDAQINSVFNKYCVNMQGQVAVRNVPMTGSISHVLVQLPHVFQRMEAENLASVIDARFNFFVNKILPQYRDAVM
Gene ID - Mouse ENSMUSG00000016181
Gene ID - Rat ENSRNOG00000004789
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DIEXF pAb (ATL-HPA026640)
Datasheet Anti DIEXF pAb (ATL-HPA026640) Datasheet (External Link)
Vendor Page Anti DIEXF pAb (ATL-HPA026640) at Atlas Antibodies

Documents & Links for Anti DIEXF pAb (ATL-HPA026640)
Datasheet Anti DIEXF pAb (ATL-HPA026640) Datasheet (External Link)
Vendor Page Anti DIEXF pAb (ATL-HPA026640)