Anti DIEXF pAb (ATL-HPA026640)

Atlas Antibodies

SKU: ATL-HPA026640-25

• 

Protein Description: digestive organ expansion factor homolog (zebrafish)
Gene Name: DIEXF
Alternative Gene Name: C1orf107, DEF, MGC29875, UTP25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016181: 93%, ENSRNOG00000004789: 94%
Entrez Gene ID: 27042
Uniprot ID: Q68CQ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLPLDSHGVDFSRVRMWSLNNWSKYYRQTLLFGALQDAQINSVFNKYCVNMQGQVAVRNVPMTGSISHVLVQLPHVFQRMEAENLASVIDARFNFFVNKILPQYRDAVM
• Gene Sequence: LLPLDSHGVDFSRVRMWSLNNWSKYYRQTLLFGALQDAQINSVFNKYCVNMQGQVAVRNVPMTGSISHVLVQLPHVFQRMEAENLASVIDARFNFFVNKILPQYRDAVM
• Gene ID - Mouse: ENSMUSG00000016181
• Gene ID - Rat: ENSRNOG00000004789
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.