Anti DIDO1 pAb (ATL-HPA049904)

Atlas Antibodies

Catalog No.:
ATL-HPA049904-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: death inducer-obliterator 1
Gene Name: DIDO1
Alternative Gene Name: BYE1, C20orf158, DATF1, DIO-1, DIO1, dJ885L7.8, FLJ11265, KIAA0333
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038914: 79%, ENSRNOG00000009936: 79%
Entrez Gene ID: 11083
Uniprot ID: Q9BTC0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PHPSQFETARGPHPNQFEGPRGQAPNFMPGPRGIQPQQFEDQRVHSPPRFTNQRAPAPLQFGGLRGSAPFSEKNEQTPSRFHFQGQ
Gene Sequence PHPSQFETARGPHPNQFEGPRGQAPNFMPGPRGIQPQQFEDQRVHSPPRFTNQRAPAPLQFGGLRGSAPFSEKNEQTPSRFHFQGQ
Gene ID - Mouse ENSMUSG00000038914
Gene ID - Rat ENSRNOG00000009936
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DIDO1 pAb (ATL-HPA049904)
Datasheet Anti DIDO1 pAb (ATL-HPA049904) Datasheet (External Link)
Vendor Page Anti DIDO1 pAb (ATL-HPA049904) at Atlas Antibodies

Documents & Links for Anti DIDO1 pAb (ATL-HPA049904)
Datasheet Anti DIDO1 pAb (ATL-HPA049904) Datasheet (External Link)
Vendor Page Anti DIDO1 pAb (ATL-HPA049904)
Citations for Anti DIDO1 pAb (ATL-HPA049904) – 1 Found
Cao, Honghua; Wang, Lilan; Geng, Chengkui; Yang, Man; Mao, Wenwen; Yang, Linlin; Ma, Yin; He, Ming; Zhou, Yeying; Liu, Lianqing; Hu, Xuejiao; Yu, Jingxing; Shen, Xiufen; Gu, Xuezhong; Yin, Liefen; Shen, Zhenglei. In leukemia, knock-down of the death inducer-obliterator gene would inhibit the proliferation of endothelial cells by inhibiting the expression of CDK6 and CCND1. Peerj. 10( 35178295):e12832.  PubMed