Anti DIDO1 pAb (ATL-HPA049904)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049904-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: DIDO1
Alternative Gene Name: BYE1, C20orf158, DATF1, DIO-1, DIO1, dJ885L7.8, FLJ11265, KIAA0333
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038914: 79%, ENSRNOG00000009936: 79%
Entrez Gene ID: 11083
Uniprot ID: Q9BTC0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PHPSQFETARGPHPNQFEGPRGQAPNFMPGPRGIQPQQFEDQRVHSPPRFTNQRAPAPLQFGGLRGSAPFSEKNEQTPSRFHFQGQ |
Gene Sequence | PHPSQFETARGPHPNQFEGPRGQAPNFMPGPRGIQPQQFEDQRVHSPPRFTNQRAPAPLQFGGLRGSAPFSEKNEQTPSRFHFQGQ |
Gene ID - Mouse | ENSMUSG00000038914 |
Gene ID - Rat | ENSRNOG00000009936 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DIDO1 pAb (ATL-HPA049904) | |
Datasheet | Anti DIDO1 pAb (ATL-HPA049904) Datasheet (External Link) |
Vendor Page | Anti DIDO1 pAb (ATL-HPA049904) at Atlas Antibodies |
Documents & Links for Anti DIDO1 pAb (ATL-HPA049904) | |
Datasheet | Anti DIDO1 pAb (ATL-HPA049904) Datasheet (External Link) |
Vendor Page | Anti DIDO1 pAb (ATL-HPA049904) |
Citations for Anti DIDO1 pAb (ATL-HPA049904) – 1 Found |
Cao, Honghua; Wang, Lilan; Geng, Chengkui; Yang, Man; Mao, Wenwen; Yang, Linlin; Ma, Yin; He, Ming; Zhou, Yeying; Liu, Lianqing; Hu, Xuejiao; Yu, Jingxing; Shen, Xiufen; Gu, Xuezhong; Yin, Liefen; Shen, Zhenglei. In leukemia, knock-down of the death inducer-obliterator gene would inhibit the proliferation of endothelial cells by inhibiting the expression of CDK6 and CCND1. Peerj. 10( 35178295):e12832. PubMed |