Anti DICER1 pAb (ATL-HPA000694)
Atlas Antibodies
- Catalog No.:
- ATL-HPA000694-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: DICER1
Alternative Gene Name: Dicer, HERNA, K12H4.8-LIKE, KIAA0928, MNG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041415: 98%, ENSRNOG00000010711: 98%
Entrez Gene ID: 23405
Uniprot ID: Q9UPY3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PTDADSAYCVLPLNVVNDSSTLDIDFKFMEDIEKSEARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLH |
Gene Sequence | PTDADSAYCVLPLNVVNDSSTLDIDFKFMEDIEKSEARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLH |
Gene ID - Mouse | ENSMUSG00000041415 |
Gene ID - Rat | ENSRNOG00000010711 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DICER1 pAb (ATL-HPA000694) | |
Datasheet | Anti DICER1 pAb (ATL-HPA000694) Datasheet (External Link) |
Vendor Page | Anti DICER1 pAb (ATL-HPA000694) at Atlas Antibodies |
Documents & Links for Anti DICER1 pAb (ATL-HPA000694) | |
Datasheet | Anti DICER1 pAb (ATL-HPA000694) Datasheet (External Link) |
Vendor Page | Anti DICER1 pAb (ATL-HPA000694) |
Citations for Anti DICER1 pAb (ATL-HPA000694) – 10 Found |
Dambal, Shweta; Giangreco, Angeline A; Acosta, Andres M; Fairchild, Andrew; Richards, Zachary; Deaton, Ryan; Wagner, Dennis; Vieth, Reinhold; Gann, Peter H; Kajdacsy-Balla, Andre; Van der Kwast, Theodorus; Nonn, Larisa. microRNAs and DICER1 are regulated by 1,25-dihydroxyvitamin D in prostate stroma. The Journal Of Steroid Biochemistry And Molecular Biology. 2017;167( 28089917):192-202. PubMed |
Montenegro, D; Romero, R; Kim, S S; Tarca, A L; Draghici, S; Kusanovic, J P; Kim, J S; Lee, D C; Erez, O; Gotsch, F; Hassan, S S; Kim, C J. Expression patterns of microRNAs in the chorioamniotic membranes: a role for microRNAs in human pregnancy and parturition. The Journal Of Pathology. 2009;217(1):113-21. PubMed |
Hill, D Ashley; Ivanovich, Jennifer; Priest, John R; Gurnett, Christina A; Dehner, Louis P; Desruisseau, David; Jarzembowski, Jason A; Wikenheiser-Brokamp, Kathryn A; Suarez, Brian K; Whelan, Alison J; Williams, Gretchen; Bracamontes, Dawn; Messinger, Yoav; Goodfellow, Paul J. DICER1 mutations in familial pleuropulmonary blastoma. Science (New York, N.y.). 2009;325(5943):965. PubMed |
Vaksman, Olga; Stavnes, Helene Tuft; Kaern, Janne; Trope, Claes G; Davidson, Ben; Reich, Reuven. miRNA profiling along tumour progression in ovarian carcinoma. Journal Of Cellular And Molecular Medicine. 2011;15(7):1593-602. PubMed |
Jafarnejad, S M; Ardekani, G S; Ghaffari, M; Martinka, M; Li, G. Sox4-mediated Dicer expression is critical for suppression of melanoma cell invasion. Oncogene. 2013;32(17):2131-9. PubMed |
Mito, Jeffrey K; Min, Hooney D; Ma, Yan; Carter, Jessica E; Brigman, Brian E; Dodd, Leslie; Dankort, David; McMahon, Martin; Kirsch, David G. Oncogene-dependent control of miRNA biogenesis and metastatic progression in a model of undifferentiated pleomorphic sarcoma. The Journal Of Pathology. 2013;229(1):132-40. PubMed |
Greenlee, Anne R; Shiao, Meng-Shin; Snyder, Elizabeth; Buaas, F William; Gu, Tongjun; Stearns, Timothy M; Sharma, Manju; Murchison, Elizabeth P; Puente, Gabriella C; Braun, Robert E. Deregulated sex chromosome gene expression with male germ cell-specific loss of Dicer1. Plos One. 7(10):e46359. PubMed |
Spoelstra, Nicole S; Cittelly, Diana M; Christenson, Jessica L; Gordon, Michael A; Elias, Anthony; Jedlicka, Paul; Richer, Jennifer K. Dicer expression in estrogen receptor-positive versus triple-negative breast cancer: an antibody comparison. Human Pathology. 2016;56( 27260947):40-51. PubMed |
Martínez de LaPiscina, Idoia; Hernández-Ramírez, Laura C; Portillo, Nancy; Gómez-Gila, Ana L; Urrutia, Inés; Martínez-Salazar, Rosa; García-Castaño, Alejandro; Aguayo, Aníbal; Rica, Itxaso; Gaztambide, Sonia; Faucz, Fabio R; Keil, Margaret F; Lodish, Maya B; Quezado, Martha; Pankratz, Nathan; Chittiboina, Prashant; Lane, John; Kay, Denise M; Mills, James L; Castaño, Luis; Stratakis, Constantine A. Rare Germline DICER1 Variants in Pediatric Patients With Cushing's Disease: What Is Their Role?. Frontiers In Endocrinology. 11( 32714280):433. PubMed |
Theotoki, Eleni I; Pantazopoulou, Vasiliki I; Georgiou, Stella; Kakoulidis, Panos; Filippa, Vicky; Stravopodis, Dimitrios J; Anastasiadou, Ema. Dicing the Disease with Dicer: The Implications of Dicer Ribonuclease in Human Pathologies. International Journal Of Molecular Sciences. 2020;21(19) PubMed |