Anti DIAPH2 pAb (ATL-HPA005647 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA005647-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: diaphanous-related formin 2
Gene Name: DIAPH2
Alternative Gene Name: DIA, DIA2, POF, POF2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034480: 82%, ENSRNOG00000019688: 39%
Entrez Gene ID: 1730
Uniprot ID: O60879
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen GGSEEPGGGRSNKRSAGNRAANEEETKNKPKLNIQIKTLADDVRDRITSFRKSTVKKEKPLIQHPIDSQVAMSEFPAAQPLYDERSLNLSEKEVLDLFEKMMEDMNLNEEKKAPLRNKDFTTKREMVVQYISAT
Gene Sequence GGSEEPGGGRSNKRSAGNRAANEEETKNKPKLNIQIKTLADDVRDRITSFRKSTVKKEKPLIQHPIDSQVAMSEFPAAQPLYDERSLNLSEKEVLDLFEKMMEDMNLNEEKKAPLRNKDFTTKREMVVQYISAT
Gene ID - Mouse ENSMUSG00000034480
Gene ID - Rat ENSRNOG00000019688
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DIAPH2 pAb (ATL-HPA005647 w/enhanced validation)
Datasheet Anti DIAPH2 pAb (ATL-HPA005647 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DIAPH2 pAb (ATL-HPA005647 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DIAPH2 pAb (ATL-HPA005647 w/enhanced validation)
Datasheet Anti DIAPH2 pAb (ATL-HPA005647 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DIAPH2 pAb (ATL-HPA005647 w/enhanced validation)
Citations for Anti DIAPH2 pAb (ATL-HPA005647 w/enhanced validation) – 5 Found
Grueb, Saskia S; Muhs, Stefanie; Popp, Yannes; Schmitt, Sebastian; Geyer, Matthias; Lin, Yuan-Na; Windhorst, Sabine. The formin Drosophila homologue of Diaphanous2 (Diaph2) controls microtubule dynamics in colorectal cancer cells independent of its FH2-domain. Scientific Reports. 2019;9(1):5352.  PubMed
Lehtimäki, Jaakko I; Rajakylä, Eeva Kaisa; Tojkander, Sari; Lappalainen, Pekka. Correction: Generation of stress fibers through myosin-driven reorganization of the actin cortex. Elife. 2022;11( 35442189)  PubMed
Shinohara, Ryota; Thumkeo, Dean; Kamijo, Hiroshi; Kaneko, Naoko; Sawamoto, Kazunobu; Watanabe, Keisuke; Takebayashi, Hirohide; Kiyonari, Hiroshi; Ishizaki, Toshimasa; Furuyashiki, Tomoyuki; Narumiya, Shuh. A role for mDia, a Rho-regulated actin nucleator, in tangential migration of interneuron precursors. Nature Neuroscience. 2012;15(3):373-80, S1-2.  PubMed
Lehtimäki, Jaakko I; Rajakylä, Eeva Kaisa; Tojkander, Sari; Lappalainen, Pekka. Generation of stress fibers through myosin-driven reorganization of the actin cortex. Elife. 2021;10( 33506761)  PubMed
Zhang, Bixi; Hu, Qing; Li, Yanchun; Xu, Canxia; Xie, Xiaoran; Liu, Peng; Xu, Meihua; Gong, Siming; Wu, Hao. Diaphanous-related formin subfamily: Novel prognostic biomarkers and tumor microenvironment regulators for pancreatic adenocarcinoma. Frontiers In Molecular Biosciences. 9( 36589226):910950.  PubMed