Anti DIAPH2 pAb (ATL-HPA005647 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA005647-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: DIAPH2
Alternative Gene Name: DIA, DIA2, POF, POF2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034480: 82%, ENSRNOG00000019688: 39%
Entrez Gene ID: 1730
Uniprot ID: O60879
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GGSEEPGGGRSNKRSAGNRAANEEETKNKPKLNIQIKTLADDVRDRITSFRKSTVKKEKPLIQHPIDSQVAMSEFPAAQPLYDERSLNLSEKEVLDLFEKMMEDMNLNEEKKAPLRNKDFTTKREMVVQYISAT |
| Gene Sequence | GGSEEPGGGRSNKRSAGNRAANEEETKNKPKLNIQIKTLADDVRDRITSFRKSTVKKEKPLIQHPIDSQVAMSEFPAAQPLYDERSLNLSEKEVLDLFEKMMEDMNLNEEKKAPLRNKDFTTKREMVVQYISAT |
| Gene ID - Mouse | ENSMUSG00000034480 |
| Gene ID - Rat | ENSRNOG00000019688 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DIAPH2 pAb (ATL-HPA005647 w/enhanced validation) | |
| Datasheet | Anti DIAPH2 pAb (ATL-HPA005647 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DIAPH2 pAb (ATL-HPA005647 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti DIAPH2 pAb (ATL-HPA005647 w/enhanced validation) | |
| Datasheet | Anti DIAPH2 pAb (ATL-HPA005647 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DIAPH2 pAb (ATL-HPA005647 w/enhanced validation) |
| Citations for Anti DIAPH2 pAb (ATL-HPA005647 w/enhanced validation) – 5 Found |
| Grueb, Saskia S; Muhs, Stefanie; Popp, Yannes; Schmitt, Sebastian; Geyer, Matthias; Lin, Yuan-Na; Windhorst, Sabine. The formin Drosophila homologue of Diaphanous2 (Diaph2) controls microtubule dynamics in colorectal cancer cells independent of its FH2-domain. Scientific Reports. 2019;9(1):5352. PubMed |
| Lehtimäki, Jaakko I; Rajakylä, Eeva Kaisa; Tojkander, Sari; Lappalainen, Pekka. Correction: Generation of stress fibers through myosin-driven reorganization of the actin cortex. Elife. 2022;11( 35442189) PubMed |
| Shinohara, Ryota; Thumkeo, Dean; Kamijo, Hiroshi; Kaneko, Naoko; Sawamoto, Kazunobu; Watanabe, Keisuke; Takebayashi, Hirohide; Kiyonari, Hiroshi; Ishizaki, Toshimasa; Furuyashiki, Tomoyuki; Narumiya, Shuh. A role for mDia, a Rho-regulated actin nucleator, in tangential migration of interneuron precursors. Nature Neuroscience. 2012;15(3):373-80, S1-2. PubMed |
| Lehtimäki, Jaakko I; Rajakylä, Eeva Kaisa; Tojkander, Sari; Lappalainen, Pekka. Generation of stress fibers through myosin-driven reorganization of the actin cortex. Elife. 2021;10( 33506761) PubMed |
| Zhang, Bixi; Hu, Qing; Li, Yanchun; Xu, Canxia; Xie, Xiaoran; Liu, Peng; Xu, Meihua; Gong, Siming; Wu, Hao. Diaphanous-related formin subfamily: Novel prognostic biomarkers and tumor microenvironment regulators for pancreatic adenocarcinoma. Frontiers In Molecular Biosciences. 9( 36589226):910950. PubMed |