Anti DIABLO pAb (ATL-HPA001825 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA001825-25
  • Immunohistochemistry analysis in human testis and skeletal muscle tissues using Anti-DIABLO antibody. Corresponding DIABLO RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: diablo, IAP-binding mitochondrial protein
Gene Name: DIABLO
Alternative Gene Name: DFNA64, DIABLO-S, FLJ10537, FLJ25049, SMAC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029433: 88%, ENSRNOG00000029197: 88%
Entrez Gene ID: 56616
Uniprot ID: Q9NR28
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEG
Gene Sequence AVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEG
Gene ID - Mouse ENSMUSG00000029433
Gene ID - Rat ENSRNOG00000029197
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti DIABLO pAb (ATL-HPA001825 w/enhanced validation)
Datasheet Anti DIABLO pAb (ATL-HPA001825 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DIABLO pAb (ATL-HPA001825 w/enhanced validation)