Anti DHX9 pAb (ATL-HPA028050)

Atlas Antibodies

Catalog No.: ATL-HPA028050-100

Protein Description: DEAH (Asp-Glu-Ala-His) box helicase 9
Gene Name: DHX9
Alternative Gene Name: DDX9, LKP, RHA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042699: 95%, ENSRNOG00000002735: 94%
Entrez Gene ID: 1660
Uniprot ID: Q08211
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PHLALKAENNSEVGASGYGVPGPTWDRGANLKDYYSRKEEQEVQATLESEEVDLNAGLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSF
• Gene Sequence: PHLALKAENNSEVGASGYGVPGPTWDRGANLKDYYSRKEEQEVQATLESEEVDLNAGLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSF
• Gene ID - Mouse: ENSMUSG00000042699
• Gene ID - Rat: ENSRNOG00000002735
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DHX9 pAb (ATL-HPA028050) – 1 Found

Bruhn, Christopher; Bastianello, Giulia; Foiani, Marco. Cancer cell histone density links global histone acetylation, mitochondrial proteome and histone acetylase inhibitor sensitivity. Communications Biology. 2022;5(1):882.