Anti DHX9 pAb (ATL-HPA028050)

Atlas Antibodies

Catalog No.:
ATL-HPA028050-100
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: DEAH (Asp-Glu-Ala-His) box helicase 9
Gene Name: DHX9
Alternative Gene Name: DDX9, LKP, RHA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042699: 95%, ENSRNOG00000002735: 94%
Entrez Gene ID: 1660
Uniprot ID: Q08211
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen PHLALKAENNSEVGASGYGVPGPTWDRGANLKDYYSRKEEQEVQATLESEEVDLNAGLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSF
Gene Sequence PHLALKAENNSEVGASGYGVPGPTWDRGANLKDYYSRKEEQEVQATLESEEVDLNAGLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSF
Gene ID - Mouse ENSMUSG00000042699
Gene ID - Rat ENSRNOG00000002735
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DHX9 pAb (ATL-HPA028050)
Datasheet Anti DHX9 pAb (ATL-HPA028050) Datasheet (External Link)
Vendor Page Anti DHX9 pAb (ATL-HPA028050) at Atlas Antibodies

Documents & Links for Anti DHX9 pAb (ATL-HPA028050)
Datasheet Anti DHX9 pAb (ATL-HPA028050) Datasheet (External Link)
Vendor Page Anti DHX9 pAb (ATL-HPA028050)
Citations for Anti DHX9 pAb (ATL-HPA028050) – 1 Found
Bruhn, Christopher; Bastianello, Giulia; Foiani, Marco. Cancer cell histone density links global histone acetylation, mitochondrial proteome and histone acetylase inhibitor sensitivity. Communications Biology. 2022;5(1):882.  PubMed