Anti DHX58 pAb (ATL-HPA019570)

Atlas Antibodies

Catalog No.:
ATL-HPA019570-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: DEXH (Asp-Glu-X-His) box polypeptide 58
Gene Name: DHX58
Alternative Gene Name: D11LGP2, LGP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017830: 81%, ENSRNOG00000018247: 80%
Entrez Gene ID: 79132
Uniprot ID: Q96C10
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GLLTNEISMVQARGRARADQSVYAFVATEGSRELKRELINEALETLMEQAVAAVQKMDQAEYQAKIRDLQQAALTKRAAQAAQRENQRQQFPVEHVQLLCINCMVAV
Gene Sequence GLLTNEISMVQARGRARADQSVYAFVATEGSRELKRELINEALETLMEQAVAAVQKMDQAEYQAKIRDLQQAALTKRAAQAAQRENQRQQFPVEHVQLLCINCMVAV
Gene ID - Mouse ENSMUSG00000017830
Gene ID - Rat ENSRNOG00000018247
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DHX58 pAb (ATL-HPA019570)
Datasheet Anti DHX58 pAb (ATL-HPA019570) Datasheet (External Link)
Vendor Page Anti DHX58 pAb (ATL-HPA019570) at Atlas Antibodies

Documents & Links for Anti DHX58 pAb (ATL-HPA019570)
Datasheet Anti DHX58 pAb (ATL-HPA019570) Datasheet (External Link)
Vendor Page Anti DHX58 pAb (ATL-HPA019570)
Citations for Anti DHX58 pAb (ATL-HPA019570) – 1 Found
Mura, Marie; Combredet, Chantal; Najburg, Valérie; Sanchez David, Raul Y; Tangy, Frédéric; Komarova, Anastassia V. Nonencapsidated 5' Copy-Back Defective Interfering Genomes Produced by Recombinant Measles Viruses Are Recognized by RIG-I and LGP2 but Not MDA5. Journal Of Virology. 2017;91(20)  PubMed