Anti DHX58 pAb (ATL-HPA018670)
Atlas Antibodies
- Catalog No.:
- ATL-HPA018670-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: DHX58
Alternative Gene Name: D11LGP2, LGP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017830: 71%, ENSRNOG00000018247: 76%
Entrez Gene ID: 79132
Uniprot ID: Q96C10
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AINHVLQLCANLDTWCIMSPQNCCPQLQEHSQQPCKQYNLCHRRSQDPFGDLLKKLMDQIHDHLEMPELSRKFGTQMYEQQVVKLS |
| Gene Sequence | AINHVLQLCANLDTWCIMSPQNCCPQLQEHSQQPCKQYNLCHRRSQDPFGDLLKKLMDQIHDHLEMPELSRKFGTQMYEQQVVKLS |
| Gene ID - Mouse | ENSMUSG00000017830 |
| Gene ID - Rat | ENSRNOG00000018247 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DHX58 pAb (ATL-HPA018670) | |
| Datasheet | Anti DHX58 pAb (ATL-HPA018670) Datasheet (External Link) |
| Vendor Page | Anti DHX58 pAb (ATL-HPA018670) at Atlas Antibodies |
| Documents & Links for Anti DHX58 pAb (ATL-HPA018670) | |
| Datasheet | Anti DHX58 pAb (ATL-HPA018670) Datasheet (External Link) |
| Vendor Page | Anti DHX58 pAb (ATL-HPA018670) |