Anti DHX58 pAb (ATL-HPA018670)

Atlas Antibodies

Catalog No.: ATL-HPA018670-25

Protein Description: DEXH (Asp-Glu-X-His) box polypeptide 58
Gene Name: DHX58
Alternative Gene Name: D11LGP2, LGP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017830: 71%, ENSRNOG00000018247: 76%
Entrez Gene ID: 79132
Uniprot ID: Q96C10
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AINHVLQLCANLDTWCIMSPQNCCPQLQEHSQQPCKQYNLCHRRSQDPFGDLLKKLMDQIHDHLEMPELSRKFGTQMYEQQVVKLS
• Gene Sequence: AINHVLQLCANLDTWCIMSPQNCCPQLQEHSQQPCKQYNLCHRRSQDPFGDLLKKLMDQIHDHLEMPELSRKFGTQMYEQQVVKLS
• Gene ID - Mouse: ENSMUSG00000017830
• Gene ID - Rat: ENSRNOG00000018247
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.